SecReT6
Protein ID: 296102173
SecReT6 ID396
T6SS typei2
Gene symbolvasJ
Locus tagECL_01814
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1838342..1839940 [+]
Producttype VI secretion system protein VasJ
NoteTssA
UniProt IDD5C7Y9
KEGG IDenc:ECL_01814
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.10E-21, Aligned region: 67..127
Protein Sequence: 532 a.a.     [Download]
>gi|296102173|ref|YP_003612319.1| type VI secretion system protein VasJ [Enterobacter cloacae subsp. cloacae ATCC 13047]
MDILQNLVAACQADETLLRQQAQTRTERWLRWLAPVSVTCPTGEDPGYDDDFQRIREEVNKLSGIDTGLI
CTLAEKLMTTTAKDIRVATYYCWARLHQNGEAGFAEGLELVAGLLQRYGMQLHPRRDRSRKAALEWLGGT
RVLDSLSLYPEVVREDAQRTAGTLLLIADSLETEPEALRAELNALYSALESRLMKGGGVDAVVPQNASNQ
TRSQQPSHTTEQDAPVLSRITSGQDLLAQARTLTGYLREQPGGWLAAHRLMKSLRHDTLSAIPAPDAEGK
TRIEPPRADQRAMLKRLYLQQSWLEILEQADNTFSRGANHLWLDLQWYTHQALMKSGQDVLADIITADLK
GLLRRLTGLETLAFNDGTPFADEVTLNWINQSVLDDMSGWRDEPVSAISTGDNDILALEPEALEKADSEG
LDATLHWLQTRPGTDTKDRWLLRLLMARVAEQKGKNELALHLLGELDNAAQSITLAQWTPALLFEVKSRR
FRLLCIKATRSEADKSRLQPEMDQLLTGLIALDPAGSAVLCG
 
Nucleotide Sequence: 1599 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1838342-1839940 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGGATATTTTGCAGAATCTGGTGGCCGCCTGTCAGGCGGATGAAACCCTGTTGCGACAGCAGGCGCAGA
CTCGTACGGAACGCTGGCTGCGCTGGCTTGCTCCGGTCAGCGTGACCTGTCCGACGGGAGAAGACCCGGG
ATATGACGATGATTTCCAGCGCATTCGCGAGGAGGTCAATAAGCTTTCCGGCATCGATACCGGGCTGATT
TGCACGCTTGCCGAAAAACTGATGACCACCACGGCAAAAGATATCCGGGTTGCGACTTATTACTGCTGGG
CGCGCCTGCATCAGAATGGCGAAGCTGGCTTCGCCGAAGGGCTTGAACTGGTGGCAGGATTACTGCAGCG
CTACGGCATGCAGCTTCACCCCCGGCGGGACCGCAGCCGCAAGGCCGCGCTGGAATGGCTCGGCGGTACC
CGTGTACTGGACAGTTTGTCACTGTACCCGGAGGTCGTACGCGAGGATGCACAGCGTACCGCCGGGACGC
TACTGCTCATTGCTGACAGCCTGGAGACAGAGCCTGAAGCGTTACGGGCGGAGCTGAATGCCCTGTACAG
CGCTCTTGAGTCCCGTCTGATGAAAGGCGGGGGCGTGGATGCCGTGGTACCGCAGAACGCAAGCAATCAG
ACACGTAGTCAGCAGCCATCTCACACGACAGAACAGGACGCGCCAGTGCTGAGCCGCATCACCTCGGGTC
AGGACTTACTGGCTCAGGCTCGCACCCTGACGGGGTACCTGCGTGAGCAACCCGGTGGCTGGCTTGCGGC
GCACCGGCTGATGAAAAGCCTGCGTCATGACACGCTGAGCGCTATTCCGGCACCGGATGCTGAAGGGAAA
ACGCGCATCGAGCCGCCGCGAGCTGACCAGCGGGCGATGCTCAAGCGCCTCTATCTGCAACAGAGCTGGC
TGGAAATACTGGAGCAGGCGGACAATACCTTCTCGCGCGGTGCCAATCACCTCTGGCTGGATTTGCAGTG
GTATACCCATCAGGCCCTGATGAAGTCGGGGCAGGATGTGCTGGCCGACATCATCACTGCCGACCTGAAA
GGGCTGCTGCGCCGTCTTACCGGGCTTGAAACCCTGGCCTTTAACGACGGGACACCGTTTGCCGATGAGG
TCACGCTGAACTGGATAAACCAGAGCGTGCTGGACGATATGTCCGGCTGGCGGGATGAACCTGTCAGCGC
TATCAGTACTGGTGATAACGATATTCTGGCGCTTGAACCTGAAGCACTGGAGAAAGCAGACAGCGAAGGA
CTGGATGCCACACTCCACTGGCTGCAGACGCGCCCGGGGACCGACACCAAAGACAGATGGTTGCTGCGTC
TGCTGATGGCCCGTGTGGCAGAGCAGAAAGGTAAAAATGAACTGGCCCTGCATTTACTGGGTGAGCTCGA
CAATGCCGCACAGTCCATCACCCTCGCACAGTGGACGCCGGCGCTGTTGTTTGAAGTGAAATCACGCCGC
TTCCGACTGCTGTGCATAAAAGCCACACGCAGTGAAGCCGATAAGTCACGGCTTCAGCCGGAGATGGACC
AGCTTCTGACTGGTCTGATTGCGCTTGACCCGGCAGGCAGTGCGGTGCTTTGCGGGTAA