SecReT6
Protein ID: 296102174
SecReT6 ID396
T6SS typei2
Gene symbol-
Locus tagECL_01815
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1839974..1840165 [+]
Producthypothetical protein
NotePAAR
UniProt IDD5C7Z0
KEGG IDenc:ECL_01815
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.30E-08, Aligned region: 10..45
Protein Sequence: 63 a.a.     [Download]
>gi|296102174|ref|YP_003612320.1| hypothetical protein ECL_01815 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MPAKGFYLVQGDKTTCGGRIITGAEDHTLFGKPVAREQDGVTCGKFVGLYKVAGALLNKSNFC
 
Nucleotide Sequence: 192 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1839974-1840165 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGCCAGCAAAAGGTTTTTATCTGGTTCAGGGTGACAAAACGACCTGCGGTGGAAGAATTATCACGGGCG
CAGAAGATCACACACTGTTTGGTAAACCTGTTGCCAGGGAGCAGGACGGCGTGACCTGTGGTAAGTTTGT
AGGGCTTTACAAGGTCGCCGGGGCTTTGTTGAATAAATCGAACTTTTGCTGA