SecReT6
Protein ID: 296102177
SecReT6 ID396
T6SS typei2
Gene symbolimpH
Locus tagECL_01818
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1842623..1843708 [+]
Producttype VI secretion system protein ImpH
NoteTssG
UniProt IDD5C7Z3
KEGG IDenc:ECL_01818
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.30E-75, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|296102177|ref|YP_003612323.1| type VI secretion system protein ImpH [Enterobacter cloacae subsp. cloacae ATCC 13047]
MGREAQSPHSRLTPRLEADLHRMNFYRFCQLLEKRHPGRPLMGSTSHPADDPVRFAPHPGMGFPAGELKC
VEYDEDDDNTPPVIRATFMGMYGVDSPLPTAYLDDITQRREGHDALQGFLDIFSHRILTQFYRIWRKYSY
PATFEPGGTDSISQSLLGLVGLGIPGTANHIATPVSRFLALLGVLQQPGKTQEGIQALVSLLAPDTTVTV
SPYCLRPVEVSQPLGFYGDDDFLLDGNTPLGDEAMDASSQLLIALSTDNEQESQGWKPDGLLYQDFLVML
RVYLGWRFKAKITLTTLTRLLAVPPLGEGSFWLGMNGVLGAEEGAFADDIPQTFTTELGYYTGLQPATPQ
QGNRRVTYKFD
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1842623-1843708 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGGGAAGAGAAGCACAGTCGCCGCATTCCCGGCTGACCCCGCGGCTGGAAGCCGACCTGCACCGCATGA
ATTTTTATCGTTTCTGTCAGTTGCTGGAGAAACGTCATCCGGGCAGGCCACTGATGGGTTCAACCAGTCA
TCCCGCAGATGATCCGGTACGCTTTGCACCGCATCCGGGGATGGGTTTTCCAGCCGGTGAACTGAAGTGT
GTCGAATATGACGAAGACGATGACAACACACCTCCGGTTATTCGAGCGACCTTCATGGGGATGTACGGTG
TCGATTCCCCCTTGCCGACGGCGTATCTTGATGACATCACTCAGCGCCGTGAAGGACATGATGCGCTGCA
GGGGTTTCTGGATATCTTTAGCCACCGCATCCTGACGCAGTTTTACCGCATCTGGCGTAAGTACTCTTAC
CCGGCCACCTTTGAGCCCGGCGGGACCGACAGCATTTCGCAGTCGCTGCTGGGCCTGGTGGGGCTGGGTA
TTCCCGGCACCGCGAACCACATTGCCACACCGGTATCCCGTTTTCTGGCTCTGCTGGGTGTACTTCAGCA
ACCGGGGAAAACCCAGGAGGGGATACAGGCCCTGGTGAGCCTGCTGGCACCGGATACCACTGTGACGGTC
AGCCCGTACTGCCTGCGTCCGGTGGAGGTCAGTCAGCCACTGGGTTTTTACGGTGATGACGATTTTCTAC
TGGATGGCAACACGCCACTTGGAGATGAAGCGATGGATGCCAGCAGCCAGCTGCTGATCGCGCTGTCCAC
CGATAACGAACAGGAATCACAGGGATGGAAACCGGACGGTCTGCTGTATCAGGACTTCCTGGTGATGCTG
CGTGTCTACCTTGGCTGGCGTTTTAAGGCAAAAATCACCCTGACAACCCTAACCCGCCTGCTGGCCGTGC
CACCGCTCGGTGAAGGATCTTTCTGGCTCGGCATGAATGGCGTACTGGGGGCGGAGGAGGGAGCGTTTGC
AGATGATATCCCGCAAACCTTTACGACGGAACTGGGCTATTACACTGGCCTGCAACCTGCAACACCACAA
CAAGGAAACCGACGTGTTACGTACAAGTTTGATTAA