SecReT6
Protein ID: 296102178
SecReT6 ID396
T6SS typei2
Gene symbolvasD
Locus tagECL_01819
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1843686..1844231 [+]
Producttype VI secretion system protein VasD
NoteTssJ
UniProt IDD5C7Z4
KEGG IDenc:ECL_01819
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.70E-36, Aligned region: 19..172
Protein Sequence: 181 a.a.     [Download]
>gi|296102178|ref|YP_003612324.1| type VI secretion system protein VasD [Enterobacter cloacae subsp. cloacae ATCC 13047]
MLRTSLIKPACWLPALLAFSLTGCGITQGITDGTKSAFNAVFYKKIKVLHLDFTAREALNTDSRESNSLS
EPVVVRVYQLKDRKIFDKTVYQQLLKDGETILKADLLTSRDVVVKPGGDVSLDMPMEEEAHFVAVVGLFR
HPDMVNNTWKQVLRREDLDPDKPRILEAGNNHLTLQPRKDD
 
Nucleotide Sequence: 546 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1843686-1844231 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
GTGTTACGTACAAGTTTGATTAAACCCGCGTGCTGGCTGCCTGCACTGCTGGCGTTCAGCCTCACGGGCT
GTGGGATTACGCAGGGTATCACTGATGGCACTAAATCGGCATTTAACGCTGTGTTTTATAAAAAAATTAA
GGTACTGCATCTGGATTTCACCGCCCGTGAAGCGTTGAACACCGATTCCCGCGAAAGTAACTCGCTGTCT
GAGCCGGTGGTAGTCCGCGTATATCAACTGAAAGACCGCAAGATCTTCGACAAAACGGTCTATCAGCAGC
TGCTGAAGGACGGGGAGACCATTCTTAAAGCGGACCTTCTGACCAGCCGTGACGTGGTGGTGAAGCCGGG
CGGAGATGTGAGCCTTGATATGCCGATGGAAGAAGAAGCGCATTTTGTCGCGGTGGTCGGGCTGTTCCGC
CATCCGGATATGGTTAACAACACCTGGAAACAGGTGCTCAGACGTGAAGATCTCGATCCGGATAAACCGC
GCATTCTTGAAGCCGGGAATAACCATCTGACATTACAACCGCGAAAGGATGACTGA