SecReT6
Protein ID: 296102179
SecReT6 ID396
T6SS typei2
Gene symbol-
Locus tagECL_01820
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1844231..1844686 [+]
Producttype VI secretion system protein
NoteTssE
UniProt IDD5C7Z5
KEGG IDenc:ECL_01820
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.90E-14, Aligned region: 31..117
Protein Sequence: 151 a.a.     [Download]
>gi|296102179|ref|YP_003612325.1| type VI secretion system protein [Enterobacter cloacae subsp. cloacae ATCC 13047]
MPQGHNTPSLYEMLTGNFSGGLSLHQVSEQNQVILSVLDNMQRVLNCRAGTLAHLPDYGLPDMTKILQGM
PGTTHELMEILSSVLLKYEPRLKRIDVVLLEQAIPGELRYAIDAELKGIGLVRYGTEFMPEGRVLIRHLK
QQQYLDTRAAL
 
Nucleotide Sequence: 456 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1844231-1844686 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGCCACAGGGACATAACACGCCATCGCTGTATGAAATGCTGACTGGTAATTTTTCCGGTGGTCTGAGCC
TGCACCAGGTCAGTGAGCAGAACCAGGTGATTTTATCCGTACTTGATAACATGCAGCGCGTGCTCAACTG
CCGCGCCGGTACGCTGGCGCACCTGCCGGACTATGGTCTCCCGGATATGACCAAAATTCTGCAGGGGATG
CCGGGTACGACCCATGAACTGATGGAGATCTTATCGTCTGTATTGCTTAAGTACGAGCCCCGGCTTAAGA
GAATCGATGTGGTGTTGCTTGAACAGGCTATTCCCGGCGAACTGCGCTACGCCATCGACGCGGAGTTGAA
GGGCATCGGTCTGGTCCGTTACGGTACGGAATTTATGCCGGAGGGCAGGGTGTTAATCCGCCACCTGAAA
CAGCAGCAGTACCTTGATACCCGCGCCGCACTCTGA