SecReT6
Protein ID: 296102180
SecReT6 ID396
T6SS typei2
Gene symbolvasL
Locus tagECL_01821
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1844710..1846026 [+]
Producttype VI secretion system protein VasL
NoteTssA
UniProt IDD5C7Z6
KEGG IDenc:ECL_01821
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.60E-52, Aligned region: 108..171
DUF3702 [PF12486], Evalue: 2.60E-52, Aligned region: 289..434
ImpA-rel_N [PF06812], Evalue: 3.20E-18, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 3.20E-18, Aligned region: 341..359
Protein Sequence: 438 a.a.     [Download]
>gi|296102180|ref|YP_003612326.1| type VI secretion system protein VasL [Enterobacter cloacae subsp. cloacae ATCC 13047]
MTTQSERHLKTGGDPRTLADYAALRDEMNKLTHPARPDINWPQAEKLCLSLFEHNGVELQTAAWYTLVRT
HLAGLYGMNEGLAIVDALLSRQWGNIWPQPVHTRMEILSALSRRLQQTMRTMTLTCTDLSQLYQTEEHLN
ALGDILQRLELRHASQLDALRTQVHNAAVRLENSEGGQEAGGAVLPASFTTPAEHVRWVYVAQPEPLPDR
QVMTAPPPVKPWKPFAAGMATMLVIASSVAWGWQTMHTPDPAQTQLDATLAPLPDELSKAQLQALRQVSL
SPVAGLSKTQNRLAQLRELKPDWAWRYGDSLVQQALILWPQEAKPLAQQWQQQVNVAALPQPYLTGWHQG
MTQLQQLANRLNALDEQRGKYMTVSELKSAVFTMMQAFNSAVPAEEQLRQLADLPENQPWPVAQQSQTEQ
HLQQLIARYALMKQKTAE
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1844710-1846026 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGACGACACAATCCGAACGCCACCTCAAAACCGGCGGCGACCCGCGTACGCTTGCGGATTACGCCGCCC
TGCGTGACGAAATGAACAAACTGACCCACCCGGCGCGACCGGACATCAACTGGCCGCAGGCGGAAAAGCT
CTGTCTGTCGCTGTTTGAGCACAACGGGGTGGAACTGCAGACCGCGGCCTGGTATACGCTCGTCCGAACG
CATCTGGCCGGTCTATACGGCATGAACGAAGGACTGGCAATAGTGGACGCACTCCTCTCCCGCCAGTGGG
GCAATATCTGGCCGCAGCCTGTGCATACGCGTATGGAAATTCTCAGCGCGCTCAGCAGGCGGTTACAACA
GACGATGCGCACCATGACGCTGACCTGTACCGACCTCAGCCAGTTGTACCAGACAGAAGAGCACCTGAAC
GCACTGGGCGACATATTGCAGCGTCTTGAACTGAGGCATGCCAGCCAGCTCGATGCCCTGCGTACCCAGG
TCCATAACGCGGCGGTACGGCTGGAAAACAGCGAGGGCGGGCAGGAGGCGGGCGGTGCTGTTCTCCCGGC
CAGCTTTACGACCCCGGCAGAACACGTCAGGTGGGTCTATGTCGCGCAGCCGGAGCCGCTGCCGGACAGG
CAGGTGATGACCGCGCCGCCTCCGGTGAAGCCCTGGAAGCCATTTGCCGCCGGAATGGCGACCATGCTGG
TGATTGCCAGCTCGGTGGCATGGGGATGGCAGACGATGCATACACCAGACCCGGCTCAAACACAGCTCGA
TGCCACTCTGGCGCCTTTACCTGACGAATTATCCAAAGCGCAGTTGCAGGCGCTGCGACAAGTGTCACTA
TCACCCGTGGCAGGGCTTAGCAAGACGCAAAATCGGCTCGCACAGCTTAGGGAACTGAAACCTGACTGGG
CATGGCGCTACGGCGATAGCCTGGTGCAGCAGGCGCTGATCCTTTGGCCGCAAGAGGCGAAACCGCTGGC
GCAACAGTGGCAGCAGCAGGTTAACGTTGCTGCACTTCCGCAGCCATATCTGACTGGCTGGCATCAGGGA
ATGACCCAATTGCAACAACTGGCGAACCGGCTTAACGCACTTGATGAACAGCGGGGTAAGTACATGACGG
TCAGCGAGCTGAAATCAGCGGTATTTACCATGATGCAGGCATTTAACAGTGCCGTGCCTGCAGAGGAACA
ACTGCGACAGCTGGCAGATCTTCCTGAAAACCAGCCGTGGCCTGTCGCGCAGCAGAGCCAGACAGAACAG
CATCTGCAGCAGTTGATTGCTCGTTATGCCCTGATGAAACAAAAAACGGCGGAATAG