SecReT6
Protein ID: 299770673
SecReT6 ID400
T6SS typei4b
Gene symbol-
Locus tagAOLE_12195
StrainAcinetobacter oleivorans DR1
Repliconchromosome [GenBank: NC_014259] [Browse all T6SS(s) in this replicon]
Location [Strand]2617926..2618732 [-]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDD8JMK1
KEGG IDacd:AOLE_12195
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.90E-54, Aligned region: 34..239
Protein Sequence: 268 a.a.     [Download]
>gi|299770673|ref|YP_003732699.1| DotU family type IV / VI secretion system protein [Acinetobacter oleivorans DR1]
MSQSTGAPSLFDDGQIGTGGNNNSQSQAKLQAINLIDLLHDGFYLVFLIRNQYVPADAQQFREKILNLLN
QFEQQAKKLQFSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNAWLISPLQLSLFGSQLAGYRFFEILE
QLRSRGKERLAALEVFHYCLLLGFQGKYRIESTESLNHLVSRVGDEIDYLKGKKVAFSPFSAIPDQIRNI
IHREVPFFWILIFLLIFALLTFAGLRFMLNNQNDKALSNYQNVISAPQEQAHITIYLP
 
Nucleotide Sequence: 807 bp     [Download]
>gi|299768250|ref|NC_014259.1|:c2618732-2617926 Acinetobacter oleivorans DR1 chromosome, complete genome
ATGTCACAATCCACAGGTGCTCCTTCTTTATTTGATGATGGGCAGATTGGAACGGGCGGGAACAATAATA
GCCAGTCTCAAGCAAAACTACAGGCAATCAATCTTATTGATTTATTGCATGACGGCTTTTATTTGGTTTT
CTTGATTCGAAATCAGTATGTGCCAGCAGATGCTCAGCAATTTCGTGAAAAAATCTTAAATTTACTCAAT
CAATTTGAGCAACAAGCCAAAAAGTTACAATTTTCAGCTGATGATATTCATGATGCTAAATATGCATTCT
GTGCTTTGATTGATGAAACGATCGTAACGCAACAAGACCCAAGTTATTTTAATTTGCAAAATGCTTGGTT
AATTAGCCCGTTACAATTGAGCTTGTTTGGTTCTCAGTTAGCGGGTTATCGCTTCTTTGAAATATTGGAG
CAATTACGTAGCCGTGGAAAAGAACGTCTAGCTGCTTTAGAAGTATTTCATTACTGCCTTTTATTAGGTT
TTCAGGGTAAGTACCGAATCGAATCTACGGAAAGTCTCAACCATTTAGTATCAAGAGTCGGTGACGAAAT
TGACTATTTGAAAGGGAAAAAAGTTGCTTTTTCGCCGTTCTCGGCCATTCCCGATCAGATACGAAATATT
ATTCATCGTGAAGTACCTTTCTTTTGGATTTTGATCTTTTTATTGATTTTTGCATTGCTTACCTTTGCAG
GGCTAAGATTTATGCTGAATAATCAAAATGATAAAGCATTATCTAATTATCAAAATGTGATTTCTGCTCC
TCAAGAGCAAGCACATATTACAATTTATTTACCTTGA