SecReT6
Protein ID: 299770674
SecReT6 ID400
T6SS typei4b
Gene symbol-
Locus tagAOLE_12200
StrainAcinetobacter oleivorans DR1
Repliconchromosome [GenBank: NC_014259] [Browse all T6SS(s) in this replicon]
Location [Strand]2618750..2620114 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDD8JMK2
KEGG IDacd:AOLE_12200
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.90E-125, Aligned region: 19..451
Protein Sequence: 454 a.a.     [Download]
>gi|299770674|ref|YP_003732700.1| type VI secretion protein [Acinetobacter oleivorans DR1]
MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGIQKLSFDEAQLSTHILALESVEMIWQ
DGEIYQAPAYDLLPEPILLDDLNLRGEMLIYLALPLLQANKQNLIDQNQAQKGRYQSHLVETHDLFTNAT
EADISLLRRRAVFKLLDVHSNPDHNLDGFLYLPIGKIKRQSSGAFEIDRKFIPPILHVDASETLISNLKR
TLNVIKAKIKTIQTNNRENEQKLIEFRSGDIVSFWLVNALNTAHAGLNHFVQYPQIHPERLFFELLRLAG
SLLTFSTAYDVDQLPAYKHHNLQESFSQLDTILRDLLDTIISSRYISIALKEIRPSYWVGSLETDKITRD
TRLYIAVSSSAMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLIQVPTAIPVRSGVSYFEIEPH
HELYQRMLDSETICIYVPAGFQDISIELIAVMNA
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|299768250|ref|NC_014259.1|:c2620114-2618750 Acinetobacter oleivorans DR1 chromosome, complete genome
ATGTTTAAAGCTGAAAAAGTCCTTTGGGGCGAAGGTTTATTTTTAAGACCTCAACATTTCCAAATTCAAG
ATACCTACCATGAACAACGCTTGAATCATACGGTTCGTGCGGTCGTACCGTTTTCATATGGTATTCAGAA
ATTAAGTTTCGATGAGGCTCAATTGAGCACACATATTCTTGCTCTTGAGTCTGTAGAGATGATCTGGCAA
GACGGTGAAATTTATCAGGCACCTGCATATGATTTATTGCCTGAGCCAATTTTATTGGATGATCTTAATT
TACGTGGTGAGATGCTAATTTATTTAGCATTGCCACTCTTGCAAGCAAATAAGCAAAATCTAATTGATCA
AAACCAAGCACAAAAGGGCAGATATCAATCTCACCTTGTCGAAACGCATGATCTTTTCACTAACGCTACC
GAAGCAGATATTAGTTTGCTACGCCGCCGTGCTGTTTTTAAATTATTAGATGTACATAGTAACCCAGACC
ATAATCTAGATGGTTTTTTATATCTGCCGATTGGAAAGATTAAACGTCAAAGTTCGGGTGCTTTTGAAAT
TGATCGAAAGTTTATTCCACCAATTTTGCATGTAGATGCATCAGAAACACTTATTTCAAATTTAAAAAGA
ACACTGAACGTTATTAAGGCAAAAATTAAGACGATTCAAACCAATAACCGAGAAAATGAACAGAAATTAA
TTGAATTCCGTTCAGGTGATATCGTTTCGTTCTGGTTAGTAAATGCGTTAAATACAGCTCATGCTGGTCT
AAATCATTTTGTGCAATATCCACAAATTCATCCAGAGCGTTTGTTCTTCGAATTATTGCGTTTAGCAGGT
TCATTATTAACGTTCTCGACGGCCTATGATGTCGATCAGTTGCCTGCCTATAAGCACCATAATTTACAAG
AAAGTTTCTCGCAGTTAGACACGATTCTACGTGATTTGCTCGATACGATTATTTCGAGTCGATATATCAG
TATTGCACTTAAAGAGATCCGACCTTCATATTGGGTGGGAAGTCTTGAGACCGATAAGATTACTCGAGAT
ACTCGACTTTATATTGCAGTATCAAGTAGCGCAATGCAGACACATGAATTAATCCAGATTGTGCCTTTAC
GATTCAAGATCGGTAGTACTTTAGATGTAGAACAACGTGTAGTTGCTGCATTACCTGCGATTCCATTGCA
TCACTTAATTCAAGTTCCAACAGCAATACCGGTACGTTCTGGTGTGAGCTATTTCGAGATTGAACCACAT
CATGAGCTTTATCAGCGCATGTTAGATTCAGAGACGATTTGTATTTATGTTCCGGCTGGTTTCCAAGATA
TCAGTATTGAACTGATTGCGGTCATGAACGCTTAA