SecReT6
Protein ID: 299770675
SecReT6 ID400
T6SS typei4b
Gene symbol-
Locus tagAOLE_12205
StrainAcinetobacter oleivorans DR1
Repliconchromosome [GenBank: NC_014259] [Browse all T6SS(s) in this replicon]
Location [Strand]2620131..2621225 [-]
ProductImpA-related N-terminal family protein
NoteTssA
UniProt IDD8JMK3
KEGG IDacd:AOLE_12205
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.00E-22, Aligned region: 55..114
Protein Sequence: 364 a.a.     [Download]
>gi|299770675|ref|YP_003732701.1| ImpA-related N-terminal family protein [Acinetobacter oleivorans DR1]
MNIDISELLEPISDSLPCGDDFSFSNEFHEIKKAKTQDDLLLDQGDWVAERKQADWDFVSNKTSVLLKEN
TKDIRLLTWLIEAWTHLYGFEGMAKGLTLSHTLLNQYWQEIHPVIEDDDLDQRIGLLQGLINQLPGLLKK
VSLTNTVPYYNLLDYDNFLYHENIRRKQTEEYDSQSGPSELEQFDQAIFNTSKTFQYSNYQDFSSVLTEW
DVLKQTLDHLMGLDSPSFGAIDSAFETIHSTLRKIYKAEAFGTGLTPVQEQATVITSSSMENQVPVQVVS
DQPAFQPQAQTHLANREQAMKVLQEIADYFQANEPHSPVSYMLQKTIKWSQMPLHEWLAQVIKDEHPLQM
VQEMLGVQPKNEYE
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|299768250|ref|NC_014259.1|:c2621225-2620131 Acinetobacter oleivorans DR1 chromosome, complete genome
ATGAATATTGATATTTCTGAACTCCTTGAACCCATTAGCGATAGCTTACCTTGTGGTGATGACTTTTCAT
TTTCTAATGAATTTCATGAAATCAAAAAGGCGAAAACACAAGATGATCTATTGCTAGATCAAGGCGATTG
GGTTGCTGAGCGAAAACAAGCCGACTGGGATTTTGTATCAAATAAAACGAGTGTTTTGCTAAAAGAGAAT
ACTAAAGATATTCGTCTATTAACTTGGCTCATAGAGGCTTGGACTCATCTTTACGGTTTTGAAGGTATGG
CGAAAGGCTTAACTTTAAGCCATACCTTACTTAATCAATACTGGCAGGAAATTCATCCTGTTATTGAAGA
TGATGACTTAGATCAACGCATTGGTTTATTACAGGGTTTAATTAATCAGTTGCCTGGCTTGTTGAAGAAA
GTCTCTTTAACCAATACAGTGCCTTATTACAATTTGCTTGATTACGATAATTTTCTATATCACGAGAACA
TTCGTCGTAAGCAAACTGAAGAGTACGATAGTCAGTCGGGACCATCGGAGTTAGAGCAGTTCGATCAAGC
TATATTCAATACGTCTAAAACTTTTCAATATTCTAATTATCAAGATTTTAGCTCAGTCTTAACCGAGTGG
GATGTTTTAAAGCAAACCCTTGACCATTTAATGGGACTCGACTCACCAAGTTTTGGTGCAATTGATTCAG
CATTTGAAACCATTCACAGCACATTACGCAAGATTTATAAAGCAGAAGCTTTTGGTACTGGACTTACGCC
AGTCCAAGAGCAGGCGACTGTCATCACGAGTTCATCTATGGAAAATCAAGTGCCTGTACAAGTTGTTTCA
GATCAGCCTGCTTTTCAGCCTCAAGCTCAAACACACTTGGCGAATCGTGAGCAAGCAATGAAAGTGCTGC
AAGAAATTGCGGATTACTTTCAGGCAAACGAGCCTCATAGTCCTGTGAGTTATATGCTTCAAAAAACCAT
TAAATGGAGTCAAATGCCGTTACATGAATGGCTAGCACAAGTCATTAAAGATGAGCATCCATTACAAATG
GTTCAGGAAATGTTAGGTGTGCAGCCTAAAAATGAATACGAATAA