SecReT6
Protein ID: 299770676
SecReT6 ID400
T6SS typei4b
Gene symbol-
Locus tagAOLE_12210
StrainAcinetobacter oleivorans DR1
Repliconchromosome [GenBank: NC_014259] [Browse all T6SS(s) in this replicon]
Location [Strand]2621247..2623925 [-]
Productchaperone ATPase
NoteTssH
UniProt IDD8JMK4
KEGG IDacd:AOLE_12210
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.00E-43, Aligned region: 228..306
AAA_2 [PF07724], Evalue: 6.00E-43, Aligned region: 605..773
AAA [PF00004], Evalue: 3.40E-22, Aligned region: 229..342
AAA [PF00004], Evalue: 3.40E-22, Aligned region: 610..717
AAA [PF00004], Evalue: 3.40E-22, Aligned region: 848..863
AAA_5 [PF07728], Evalue: 6.20E-14, Aligned region: 229..249
AAA_5 [PF07728], Evalue: 6.20E-14, Aligned region: 303..359
AAA_5 [PF07728], Evalue: 6.20E-14, Aligned region: 609..727
ClpB_D2-small [PF10431], Evalue: 9.50E-13, Aligned region: 383..396
ClpB_D2-small [PF10431], Evalue: 9.50E-13, Aligned region: 779..850
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 16..58
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 206..251
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 273..308
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 474..525
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 604..653
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 675..703
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 777..828
AAA_22 [PF13401], Evalue: 5.40E-08, Aligned region: 228..321
AAA_22 [PF13401], Evalue: 5.40E-08, Aligned region: 464..500
AAA_22 [PF13401], Evalue: 5.40E-08, Aligned region: 606..636
AAA_14 [PF13173], Evalue: 2.10E-07, Aligned region: 229..332
AAA_14 [PF13173], Evalue: 2.10E-07, Aligned region: 607..692
AAA_14 [PF13173], Evalue: 2.10E-07, Aligned region: 848..882
Sigma54_activat [PF00158], Evalue: 3.60E-07, Aligned region: 226..245
Sigma54_activat [PF00158], Evalue: 3.60E-07, Aligned region: 607..709
AAA_25 [PF13481], Evalue: 5.30E-07, Aligned region: 229..256
AAA_25 [PF13481], Evalue: 5.30E-07, Aligned region: 285..324
AAA_25 [PF13481], Evalue: 5.30E-07, Aligned region: 599..636
AAA_25 [PF13481], Evalue: 5.30E-07, Aligned region: 836..864
AAA_19 [PF13245], Evalue: 6.10E-07, Aligned region: 229..249
AAA_19 [PF13245], Evalue: 6.10E-07, Aligned region: 605..631
AAA_17 [PF13207], Evalue: 8.00E-06, Aligned region: 229..278
AAA_17 [PF13207], Evalue: 8.00E-06, Aligned region: 608..646
IstB_IS21 [PF01695], Evalue: 8.20E-06, Aligned region: 223..289
IstB_IS21 [PF01695], Evalue: 8.20E-06, Aligned region: 609..629
NACHT [PF05729], Evalue: 1.30E-05, Aligned region: 229..260
NACHT [PF05729], Evalue: 1.30E-05, Aligned region: 609..636
AAA_18 [PF13238], Evalue: 1.70E-05, Aligned region: 52..128
AAA_18 [PF13238], Evalue: 1.70E-05, Aligned region: 229..259
AAA_18 [PF13238], Evalue: 1.70E-05, Aligned region: 476..544
AAA_18 [PF13238], Evalue: 1.70E-05, Aligned region: 610..639
Zeta_toxin [PF06414], Evalue: 3.30E-05, Aligned region: 229..250
Zeta_toxin [PF06414], Evalue: 3.30E-05, Aligned region: 604..649
RuvB_N [PF05496], Evalue: 5.20E-05, Aligned region: 228..247
RuvB_N [PF05496], Evalue: 5.20E-05, Aligned region: 300..309
RuvB_N [PF05496], Evalue: 5.20E-05, Aligned region: 572..631
RuvB_N [PF05496], Evalue: 5.20E-05, Aligned region: 678..703
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 61..101
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 208..243
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 281..378
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 477..526
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 605..655
RNA_helicase [PF00910], Evalue: 0.00071, Aligned region: 230..253
RNA_helicase [PF00910], Evalue: 0.00071, Aligned region: 610..631
TIP49 [PF06068], Evalue: 0.00077, Aligned region: 229..254
TIP49 [PF06068], Evalue: 0.00077, Aligned region: 277..309
TIP49 [PF06068], Evalue: 0.00077, Aligned region: 609..644
AAA_29 [PF13555], Evalue: 0.00096, Aligned region: 221..245
AAA_29 [PF13555], Evalue: 0.00096, Aligned region: 605..620
AAA_29 [PF13555], Evalue: 0.00096, Aligned region: 713..736
DUF258 [PF03193], Evalue: 0.0022, Aligned region: 224..249
DUF258 [PF03193], Evalue: 0.0022, Aligned region: 592..634
MobB [PF03205], Evalue: 0.0048, Aligned region: 230..263
MobB [PF03205], Evalue: 0.0048, Aligned region: 608..639
T2SE [PF00437], Evalue: 0.008, Aligned region: 214..248
T2SE [PF00437], Evalue: 0.008, Aligned region: 372..458
T2SE [PF00437], Evalue: 0.008, Aligned region: 581..678
DUF2075 [PF09848], Evalue: 0.0084, Aligned region: 229..331
DUF2075 [PF09848], Evalue: 0.0084, Aligned region: 384..478
DUF2075 [PF09848], Evalue: 0.0084, Aligned region: 608..640
Protein Sequence: 892 a.a.     [Download]
>gi|299770676|ref|YP_003732702.1| chaperone ATPase [Acinetobacter oleivorans DR1]
MSNLKILITKLSTVARTALEKSANACVIQQNYEIEIEHLFLELLNQSLENDLKILLKKYKISSEALADDL
KETISQLPKGNSRTPIFAKSIVRLFEQAWLLASAEQNPVIRSGHLLVALLTAPDLYQIATRASSLFDLLP
IDSMKHKFLEICEKSVEQQDETKTPSGEAEATETVVANAKTAKTPALDQYTINLTEKAKKGGIDPVIGRE
YEIRLMLDILMRRRQNNPILTGEPGVGKTAVVEGLALKIAQGLVPNALKNVHLHVLDMGLLQAGASVKGE
FENRLKQVIQEVQASVHPIILFIDEAHTLIGAGGQAGQNDAANLLKPALARGELRTIAATTWAEYKQYFE
KDAALSRRFQVVKVEEPTEEVAVDMLRAMIPVMQQHFKLQIDDEAIVTAVHSSHRYISGRQLPDKAVSVL
DTAAARVALTQNAQPVKLDQLKAQEHNLKLEQQILENEHRQIPIHHERLETLKANLESLQKEIHETEEQW
KKELELVHKIQELEAQNHSNESEAYDQINLLRKDLAEIQGQQPLVFERVNSQIINEIISDWTGIPVGKMV
NDEIKQILTLEDKLGERVMGQDYALTQLVQGIKTSKARLEDPNKPQGVFLLVGPSGVGKTETALTLANEL
YGGEQHLITINMSEYQEAHTVSSLKGAPPGYVGYGQGGVLTEAVRRNPYSVVLLDEIEKAHSDVQELFYQ
VFDKGTLEDGEGRVIDFKNTTILLTSNAGSSVIMQACLNTPVEDWPTAEELIDHLKPSLYKQFKPAFLGR
MRVVPYFPLHDDLLVRIIKHKLGKITARIEKQYGTQVQYSEDLVELLLSRCTEVDSGARNVDNILNSTVL
PALATEILVALAEQKLPKIIMIDAKDDEIQYLLNPVAKAAKKRTSKKLKSEV
 
Nucleotide Sequence: 2679 bp     [Download]
>gi|299768250|ref|NC_014259.1|:c2623925-2621247 Acinetobacter oleivorans DR1 chromosome, complete genome
ATGAGTAATTTAAAAATTTTAATTACAAAACTTTCTACAGTTGCGCGAACTGCTTTAGAAAAATCGGCTA
ATGCTTGTGTTATTCAACAAAATTATGAAATTGAAATTGAGCATTTATTCTTAGAGTTACTTAATCAATC
TTTAGAGAATGATTTAAAGATTTTATTAAAGAAATATAAAATTTCATCTGAAGCTTTGGCTGATGATTTA
AAAGAAACAATTTCTCAATTACCGAAAGGTAATTCAAGAACTCCTATTTTTGCTAAATCTATTGTTCGTT
TGTTTGAACAAGCATGGTTATTGGCTTCGGCTGAGCAAAATCCAGTTATTCGCAGTGGTCATTTATTAGT
TGCGTTATTAACTGCACCTGATTTATATCAAATTGCGACTCGTGCTTCGAGTTTATTTGATCTTTTACCA
ATTGATTCAATGAAACATAAGTTTCTTGAAATTTGTGAGAAGAGTGTTGAACAACAAGATGAAACAAAAA
CACCTTCTGGTGAAGCTGAAGCAACAGAAACGGTTGTAGCAAATGCCAAAACTGCTAAAACACCTGCACT
TGATCAATATACGATTAATCTCACTGAAAAAGCGAAAAAAGGCGGTATAGATCCAGTTATAGGGCGTGAA
TATGAAATTCGCCTAATGCTCGATATTTTAATGCGTAGACGCCAAAACAACCCAATCTTAACTGGAGAGC
CAGGTGTTGGTAAAACAGCTGTGGTCGAAGGTTTAGCTTTAAAAATTGCTCAAGGTTTAGTGCCTAATGC
CCTAAAAAACGTGCATTTACATGTATTGGATATGGGGCTTTTACAGGCTGGAGCAAGTGTTAAAGGCGAG
TTTGAAAATCGTCTGAAACAAGTGATTCAAGAGGTCCAAGCCTCGGTTCATCCTATTATTTTATTTATTG
ATGAAGCGCATACTTTAATTGGTGCAGGTGGACAAGCTGGGCAAAATGATGCTGCAAATCTTTTAAAACC
AGCACTTGCTCGTGGTGAGTTGCGTACTATTGCTGCGACAACTTGGGCAGAATATAAACAATATTTTGAA
AAAGATGCTGCATTGAGTCGACGTTTTCAGGTAGTAAAAGTAGAAGAGCCAACCGAAGAAGTTGCCGTAG
ATATGTTGCGTGCGATGATTCCTGTTATGCAGCAGCATTTTAAATTACAAATTGATGATGAGGCGATTGT
TACAGCGGTTCACTCTTCACATCGATATATTAGTGGTCGTCAACTTCCGGATAAAGCAGTTAGTGTTCTT
GATACGGCAGCAGCACGTGTTGCGTTGACCCAAAATGCTCAACCTGTAAAGCTTGATCAGTTAAAGGCTC
AAGAGCATAACTTAAAGCTTGAACAGCAAATTTTAGAAAATGAACATCGTCAGATTCCAATTCATCATGA
ACGATTAGAAACTTTAAAAGCTAATTTAGAATCTTTGCAAAAAGAGATTCATGAAACTGAAGAGCAGTGG
AAAAAAGAATTAGAACTTGTTCATAAAATTCAGGAATTAGAAGCACAGAATCATTCTAATGAATCTGAAG
CTTATGATCAGATTAATTTACTGCGTAAAGATCTTGCTGAAATTCAAGGCCAGCAACCATTAGTATTTGA
AAGAGTAAACTCTCAAATCATTAATGAAATTATTTCTGATTGGACCGGAATTCCTGTTGGAAAAATGGTT
AATGATGAAATTAAACAGATATTAACGCTTGAAGATAAATTGGGCGAGCGTGTAATGGGGCAAGATTATG
CACTTACACAATTAGTTCAAGGCATTAAAACTTCAAAAGCAAGACTTGAAGATCCGAATAAGCCACAAGG
TGTATTTCTTTTGGTGGGTCCAAGTGGTGTAGGTAAAACTGAAACTGCATTAACTTTGGCAAATGAATTA
TATGGCGGTGAGCAGCATTTAATCACCATCAATATGTCTGAATATCAAGAAGCACATACTGTATCTTCGC
TTAAAGGTGCACCTCCTGGATATGTGGGATATGGTCAAGGTGGTGTTTTAACAGAAGCTGTTCGTCGCAA
CCCTTACAGTGTTGTGTTGCTTGATGAAATTGAAAAAGCACATAGTGATGTTCAGGAACTGTTCTATCAA
GTATTTGATAAAGGTACTTTAGAAGATGGTGAAGGACGAGTAATTGACTTTAAAAACACTACTATTTTGT
TGACTTCAAATGCTGGCTCAAGCGTGATTATGCAAGCTTGCTTAAATACACCAGTCGAAGACTGGCCGAC
AGCTGAAGAGTTGATTGACCACTTAAAACCAAGTTTATATAAGCAATTCAAGCCTGCATTTTTAGGTCGA
ATGAGAGTTGTGCCATATTTCCCATTGCATGACGATCTACTTGTACGAATTATTAAACATAAGTTAGGCA
AGATCACAGCAAGAATTGAAAAACAATACGGTACACAAGTCCAGTATTCTGAAGATTTGGTAGAGCTGCT
TTTAAGCCGCTGTACAGAAGTCGATAGTGGTGCACGTAATGTTGATAATATTTTAAATTCTACGGTGTTA
CCTGCATTGGCTACAGAAATTTTAGTGGCTTTAGCAGAGCAAAAGTTGCCAAAAATTATCATGATTGATG
CTAAAGATGACGAAATTCAATATTTACTAAATCCAGTTGCAAAAGCTGCTAAAAAAAGGACCAGTAAAAA
GTTGAAGTCAGAAGTTTAA