SecReT6
Protein ID: 299770682
SecReT6 ID400
T6SS typei4b
Gene symbol-
Locus tagAOLE_12240
StrainAcinetobacter oleivorans DR1
Repliconchromosome [GenBank: NC_014259] [Browse all T6SS(s) in this replicon]
Location [Strand]2631381..2632379 [-]
Producthypothetical protein
NoteTssG
UniProt IDD8JML0
KEGG IDacd:AOLE_12240
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-61, Aligned region: 19..311
Protein Sequence: 332 a.a.     [Download]
>gi|299770682|ref|YP_003732708.1| hypothetical protein AOLE_12240 [Acinetobacter oleivorans DR1]
MQSERWWQDSSITAELFTKPKSFEFIQATRLLRHDSSCTFGTSWGDHFKFETSFNLNFPATEIENLELTD
ERIYITNLIVGLTGIQGALPYTYTNKIKQAPRQQRAETKEFLSLFNHKLTAQYVESSITYNLPIRYEIEH
KNDYLDILHALNGYVRSQHQQTELDDYFAEFSGLMQGQNNTVHALKTMLSCIFKHEITIKEFIQESFKLA
SDQLTTLGGAQPSLLGVNTFCGETIQQIDGKIEIQIGPLKRQQYLSFLPNQELSLKLKKIVETWCSPTLS
IDLRLVLDESEIQPICLTHHNQNGLGQGSFLISREPKVHSHETCYSLIGERI
 
Nucleotide Sequence: 999 bp     [Download]
>gi|299768250|ref|NC_014259.1|:c2632379-2631381 Acinetobacter oleivorans DR1 chromosome, complete genome
ATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTATAACAGCTGAGCTCTTTACAAAGCCAAAGTCTTTTG
AATTTATTCAAGCAACACGGCTATTAAGACACGATTCAAGTTGCACATTTGGTACATCTTGGGGTGATCA
TTTTAAGTTTGAGACATCCTTTAATTTAAATTTTCCTGCTACAGAAATTGAAAATTTAGAATTAACGGAT
GAGCGGATTTATATCACGAATTTAATTGTTGGTCTTACGGGCATACAAGGCGCTTTGCCTTATACATATA
CGAATAAGATTAAGCAGGCCCCGCGTCAGCAAAGAGCAGAAACTAAAGAGTTTCTGAGCTTATTTAACCA
TAAGCTTACTGCTCAATATGTAGAGTCGAGCATTACCTATAATTTGCCGATTCGATATGAGATCGAGCAT
AAAAATGATTATCTGGATATTTTACATGCGTTGAATGGCTATGTGCGGTCGCAACATCAGCAAACAGAGC
TTGATGATTATTTTGCAGAGTTTTCTGGATTAATGCAGGGCCAGAATAATACAGTTCATGCATTAAAAAC
GATGCTGTCGTGTATTTTTAAACATGAAATTACGATCAAAGAGTTCATACAAGAGTCTTTTAAATTGGCG
AGTGACCAATTAACAACTTTAGGTGGAGCTCAGCCGAGTCTACTTGGTGTTAATACATTTTGTGGCGAAA
CTATTCAACAAATTGATGGGAAAATTGAAATTCAAATTGGGCCATTAAAGCGTCAGCAATATCTCAGTTT
TTTACCAAATCAAGAGTTAAGTTTAAAGCTTAAAAAAATTGTAGAAACTTGGTGCAGTCCAACTTTATCA
ATAGATCTTAGACTCGTATTGGATGAGTCAGAAATACAACCTATTTGTCTCACTCACCATAATCAGAATG
GTTTGGGGCAAGGTTCTTTTCTTATATCACGAGAACCGAAAGTACATAGTCATGAAACTTGCTATAGCCT
TATTGGAGAGCGAATATGA