SecReT6
Protein ID: 299770683
SecReT6 ID400
T6SS typei4b
Gene symbol-
Locus tagAOLE_12245
StrainAcinetobacter oleivorans DR1
Repliconchromosome [GenBank: NC_014259] [Browse all T6SS(s) in this replicon]
Location [Strand]2632343..2634154 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDD8JML1
KEGG IDacd:AOLE_12245
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-153, Aligned region: 5..603
Protein Sequence: 603 a.a.     [Download]
>gi|299770683|ref|YP_003732709.1| type VI secretion protein [Acinetobacter oleivorans DR1]
MIEELLPFYEKQLQEFGQQSREFSQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARIDKKLADSYDV
FTRSLFEVMFPQYLRHFPACSVVSFDDINKIKQLTEAHIVPAHTVLKSRSFKGVQCEFNTTQEVKLLPIS
LQALEFKSTPSAHMHLSQNATLNFKFEIFNNAHLCLKDEKLPIYLDAISNFPLQVLDSIFKKGTTFAIKI
GQKVVELNKNPFELTGFSEQESLLPLDQHTHHAYRLLMEYFCFPEKFNYLKLDLSFLKLLSLEESDFELL
IHFKLNLNDQAVVRNYSELNIANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLITDAHHPEFYQVYSITE
MNMVREKTSHEESYVPVLPFFAMSHYHADKARFFYSVNYQKLQPNFVEMGYSIISKNLNPSSTRSDFIST
KLLCSNRDLPHEALGQSNNILNLNDSSLARRAIVLKRPTKPYQFGQSQSEQWRVISHLSLNSLALMKGDA
VSHIKELLALYNLPLSKENYLIIESIKHLEFSLTHKLVDGKPFPMFVRGVKAELQIDSSVFRGHSLYIFS
QLLSRVFNLKVQINSFVDLVVKDYSSQQELYQCSQNVGGKTLL
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|299768250|ref|NC_014259.1|:c2634154-2632343 Acinetobacter oleivorans DR1 chromosome, complete genome
GTGATAGAAGAGCTTTTACCGTTTTACGAAAAACAACTACAAGAATTTGGTCAGCAATCTCGTGAATTTT
CGCAAAAATATCCGAAAATTGCTCAGCGTTTATCTTTAAATCAAGAGCAAATTGATGATCCGCATATTGA
GCGTCTTATACAGGCGTTTTCATTAATTGCTGCCCGCATTGATAAAAAGCTTGCTGATAGTTATGACGTA
TTTACGCGCTCTCTATTTGAGGTGATGTTCCCTCAATACTTACGTCACTTTCCTGCTTGTTCGGTAGTCA
GTTTCGACGATATAAATAAGATAAAGCAGCTCACAGAAGCGCATATTGTTCCTGCACACACCGTCTTAAA
GTCGCGTAGTTTTAAAGGGGTTCAATGTGAGTTTAATACGACGCAAGAAGTCAAATTACTCCCGATAAGT
TTGCAAGCGCTAGAGTTTAAAAGTACACCTAGTGCACATATGCATTTAAGTCAAAATGCGACTTTAAATT
TTAAATTCGAAATTTTTAACAATGCTCATCTATGTTTAAAAGATGAAAAACTACCTATTTATTTAGATGC
AATTTCTAATTTTCCACTTCAAGTGCTAGACAGTATTTTTAAGAAGGGGACAACTTTTGCTATTAAAATA
GGGCAGAAAGTTGTTGAGCTGAATAAAAATCCATTTGAATTAACTGGCTTTTCAGAGCAAGAAAGTCTAT
TGCCTCTCGATCAGCATACTCACCATGCTTATCGTTTGCTGATGGAATATTTTTGTTTTCCTGAAAAATT
TAATTATCTAAAACTCGATTTAAGTTTTTTAAAGCTTCTATCTCTAGAAGAGAGTGATTTTGAGCTGCTT
ATACATTTTAAATTAAATTTAAATGATCAAGCCGTAGTCCGAAATTATTCTGAATTAAATATCGCTAATT
TTAAATTGTTTACTACGCCAGTCATTAATTTATTTGAAAAATACGCTGAACCTCAAAAAATTGTACACAA
GCAATTAGAATACCCACTGATTACAGACGCACATCATCCTGAGTTTTATCAAGTTTATTCAATCACTGAA
ATGAATATGGTTCGTGAAAAAACTAGTCACGAAGAGAGCTATGTTCCGGTACTGCCTTTTTTCGCGATGA
GCCATTACCATGCAGACAAGGCTCGTTTTTTCTATTCAGTGAACTATCAAAAATTACAACCCAATTTCGT
CGAAATGGGGTATTCAATTATTTCTAAAAATCTAAATCCTTCGTCAACACGTTCGGATTTTATTAGCACA
AAATTATTATGTTCAAATCGTGACTTACCACATGAGGCATTGGGTCAGTCTAATAATATATTGAACCTCA
ATGATAGTAGTTTGGCTCGCCGTGCGATTGTTTTAAAAAGACCTACAAAACCATATCAATTTGGTCAAAG
TCAGAGTGAGCAGTGGCGTGTTATTTCGCACCTTTCATTGAATAGTTTAGCTTTAATGAAAGGTGATGCG
GTATCTCATATTAAAGAGTTACTTGCTTTATACAACTTACCATTGTCAAAAGAAAATTACCTAATTATTG
AATCAATCAAGCATCTTGAATTTTCACTTACTCATAAACTTGTAGATGGAAAGCCATTTCCAATGTTTGT
AAGGGGTGTGAAGGCCGAATTGCAAATTGATTCATCTGTATTTAGAGGGCATAGCCTATACATTTTTAGC
CAATTGTTAAGTCGTGTTTTTAATTTAAAGGTTCAAATTAATAGTTTCGTTGATTTGGTTGTTAAGGATT
ATTCATCTCAGCAGGAGTTATACCAATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTATAA