SecReT6
Protein ID: 299770684
SecReT6 ID400
T6SS typei4b
Gene symbol-
Locus tagAOLE_12250
StrainAcinetobacter oleivorans DR1
Repliconchromosome [GenBank: NC_014259] [Browse all T6SS(s) in this replicon]
Location [Strand]2634171..2634647 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDD8JML2
KEGG IDacd:AOLE_12250
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-18, Aligned region: 32..135
Protein Sequence: 158 a.a.     [Download]
>gi|299770684|ref|YP_003732710.1| type VI secretion system lysozyme-like protein [Acinetobacter oleivorans DR1]
MNLDRLYPYGFRSTLFDRLIPESEDYAKGLSIQQLRESVAKDLEDLLNSRVAKLDHVVDDYPLVKKSILQ
FGIIDFVGLSTANPLDRDKICQSIEQSIAAHEPRLRQIRVEMLLDGHNMGALCLSIQAYLNIHPLYEPVV
FDALLKPTTQQYVISART
 
Nucleotide Sequence: 477 bp     [Download]
>gi|299768250|ref|NC_014259.1|:c2634647-2634171 Acinetobacter oleivorans DR1 chromosome, complete genome
ATGAATTTAGATCGGCTTTATCCATATGGATTTCGTTCAACTTTGTTTGATCGCTTAATTCCTGAAAGTG
AAGATTATGCAAAGGGTCTTTCTATTCAACAGTTAAGAGAATCGGTAGCAAAAGATTTAGAAGACTTGCT
GAATAGTCGAGTCGCTAAATTGGATCATGTGGTTGATGATTATCCGCTAGTTAAAAAATCTATACTTCAG
TTCGGGATTATTGATTTCGTGGGGCTTTCTACAGCCAATCCGCTAGATCGAGACAAGATTTGCCAATCCA
TTGAACAATCAATAGCAGCTCATGAACCTAGATTAAGACAAATACGGGTAGAGATGTTGTTGGATGGACA
TAATATGGGGGCACTATGTTTAAGTATTCAGGCCTATCTAAATATTCATCCACTGTATGAACCTGTCGTT
TTTGATGCATTGCTAAAACCGACAACGCAGCAATATGTAATTTCAGCGAGAACCTAA