SecReT6
Protein ID: 299770686
SecReT6 ID400
T6SS typei4b
Gene symbol-
Locus tagAOLE_12260
StrainAcinetobacter oleivorans DR1
Repliconchromosome [GenBank: NC_014259] [Browse all T6SS(s) in this replicon]
Location [Strand]2635279..2636760 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDD8JML4
KEGG IDacd:AOLE_12260
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.50E-192, Aligned region: 65..489
Protein Sequence: 493 a.a.     [Download]
>gi|299770686|ref|YP_003732712.1| type VI secretion protein EvpB [Acinetobacter oleivorans DR1]
MNNAQSAAMPLVENEQVNLLDSIVEESRIARNEEEHSRAKSLIGELAKEVMAGTITVSENMTLSIDKRIA
EIDALISNQLSQIMHNEQFQKIESTWRGLYYFCQETPSNPLIKIRMLNTTKKELVKDFQGATDFDQSTLF
KKIYEEEYGSFGGAPYSALIGDFEFDRTPSDMYLLEQISHVAAAAHAPFISAASPSILGLESFTDIDRPR
DVSKIFETAEYVQWRSFRDSEDARYVALTLPHVLGRLPYHPKEGTATEGFNFAEDVSGANHNEYLWMNAA
YAFGTRLTNAFDMHGWCAAIRGVEGGGLVEGLPVHTFKTQDGEVVFKCPTEIAITDRREKELSDLGFIPL
VHCKNTDYAAFFGAQSTQKPKKYDNDTANANSALSSQIQYIMAVSRIAHYLKAMMRDKVGSFASAGNVEA
FLNEWLSQYVLLDDGASQEAKAQYPLREASVKVVEDPAQPGHYKSVVFLRPHFQLDELSVSLRLVTELPQ
SSN
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|299768250|ref|NC_014259.1|:c2636760-2635279 Acinetobacter oleivorans DR1 chromosome, complete genome
ATGAATAATGCTCAATCTGCAGCAATGCCTCTTGTTGAAAATGAACAAGTTAATCTTCTAGACTCGATTG
TTGAAGAGAGTCGTATTGCTCGAAATGAAGAAGAACATTCGCGTGCAAAAAGCTTAATCGGTGAACTTGC
CAAAGAAGTAATGGCAGGAACAATTACAGTTTCTGAAAATATGACTTTATCAATCGATAAGCGTATTGCA
GAAATTGATGCTCTGATTTCAAATCAATTAAGTCAGATCATGCACAATGAACAATTCCAAAAGATTGAGT
CAACTTGGCGTGGTCTTTACTACTTCTGTCAAGAAACACCTTCAAATCCTCTCATTAAAATTCGTATGTT
GAATACGACTAAAAAAGAGTTGGTCAAAGATTTTCAAGGTGCTACAGACTTTGATCAAAGTACTTTGTTC
AAAAAAATCTATGAAGAAGAATATGGATCTTTTGGTGGTGCACCATATTCGGCACTGATTGGTGATTTCG
AATTTGACCGTACGCCTTCTGATATGTATTTGCTTGAGCAAATCTCTCATGTTGCTGCAGCGGCTCATGC
ACCGTTTATTTCGGCGGCTAGTCCAAGCATTCTTGGTCTTGAATCATTTACAGATATTGATCGACCTAGA
GATGTGTCGAAAATCTTTGAAACAGCTGAATATGTTCAATGGCGTTCATTCCGTGACAGTGAAGATGCTC
GTTATGTCGCTTTAACCCTGCCGCATGTGCTGGGTCGTCTTCCTTATCATCCAAAGGAAGGAACTGCTAC
AGAAGGGTTTAACTTTGCTGAAGATGTTTCGGGTGCAAACCACAACGAATATTTGTGGATGAATGCTGCT
TATGCTTTCGGTACTCGTTTAACAAATGCATTTGATATGCATGGTTGGTGTGCTGCAATTCGTGGTGTTG
AAGGCGGTGGTTTAGTCGAAGGCTTACCTGTTCATACGTTTAAAACACAAGATGGCGAAGTGGTATTCAA
GTGCCCAACAGAAATTGCGATTACTGATCGCCGCGAAAAAGAATTAAGCGATTTGGGCTTTATTCCTTTA
GTGCATTGTAAAAATACCGATTACGCTGCTTTCTTTGGCGCGCAATCAACTCAAAAACCTAAAAAATATG
ACAATGATACAGCAAATGCTAACTCTGCTTTATCGAGTCAAATTCAGTACATCATGGCCGTTTCACGTAT
TGCTCATTATTTAAAAGCAATGATGAGAGACAAAGTGGGTAGCTTTGCTTCTGCTGGAAATGTTGAAGCA
TTCTTAAATGAGTGGTTGTCACAGTATGTATTACTTGATGATGGCGCTTCTCAAGAAGCGAAAGCTCAAT
ACCCTCTACGCGAAGCGTCTGTAAAAGTTGTAGAAGATCCTGCTCAACCAGGTCACTACAAATCTGTGGT
TTTCTTGCGACCACACTTCCAGCTGGATGAGTTGTCAGTTTCTTTGCGACTTGTTACTGAGTTACCTCAG
TCCTCAAATTAA