SecReT6
Protein ID: 299770687
SecReT6 ID400
T6SS typei4b
Gene symbol-
Locus tagAOLE_12265
StrainAcinetobacter oleivorans DR1
Repliconchromosome [GenBank: NC_014259] [Browse all T6SS(s) in this replicon]
Location [Strand]2636753..2637256 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDD8JML5
KEGG IDacd:AOLE_12265
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.60E-58, Aligned region: 11..166
Protein Sequence: 167 a.a.     [Download]
>gi|299770687|ref|YP_003732713.1| type VI secretion protein [Acinetobacter oleivorans DR1]
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKKFINVDLDNI
DEVMESLSPRAAFQVDNTLTEEGGRIAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNS
ERLEDLLDEVLKSTDQIRKLSAEADHE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|299768250|ref|NC_014259.1|:c2637256-2636753 Acinetobacter oleivorans DR1 chromosome, complete genome
ATGGCTAAGAGAGAAAGCGTACAAAAGAAGCTTCAGCGAATTCGACCTCCACGTGTTCAGCTTACATATG
ATGTCGAAATTGGTGATGCAAAAGAAGCGAAGGAACTACCATTTGTTGTTGGTGTGATGGGTGATTTTTC
GGCAGCTTCTGAGCTTGAACGTACAAAATTAAAAGATAAAAAATTCATTAATGTCGATTTAGATAATATT
GATGAAGTTATGGAGTCATTGTCTCCAAGAGCTGCTTTTCAAGTAGATAATACGCTGACTGAAGAGGGCG
GAAGAATTGCAGTTGATTTAACATTTAAGTCAATGGAAGATTTTCGCCCAGAAAATGTTGTTCAACAGGT
TGACCCATTAAAGAAACTTGTTGAAGCACGTGAGCGTTTAACAGATTTAAGAAATAAGATTTCTAACAGT
GAGCGTTTAGAAGACTTACTTGATGAAGTGCTTAAGAGTACTGATCAAATCCGTAAATTAAGTGCGGAGG
CTGATCATGAATAA