SecReT6
Protein ID: 299770695
SecReT6 ID400
T6SS typei4b
Gene symbol-
Locus tagAOLE_12305
StrainAcinetobacter oleivorans DR1
Repliconchromosome [GenBank: NC_014259] [Browse all T6SS(s) in this replicon]
Location [Strand]2644811..2647438 [-]
Producthypothetical protein
NoteTssI
UniProt IDD8JMM3
KEGG IDacd:AOLE_12305
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.10E-51, Aligned region: 44..384
DUF2345 [PF10106], Evalue: 1.30E-46, Aligned region: 199..238
DUF2345 [PF10106], Evalue: 1.30E-46, Aligned region: 693..846
T6SS_Vgr [PF13296], Evalue: 1.30E-38, Aligned region: 33..49
T6SS_Vgr [PF13296], Evalue: 1.30E-38, Aligned region: 563..671
T6SS_Vgr [PF13296], Evalue: 1.30E-38, Aligned region: 734..757
T6SS_Vgr [PF13296], Evalue: 1.30E-38, Aligned region: 770..796
Phage_base_V [PF04717], Evalue: 3.90E-18, Aligned region: 26..41
Phage_base_V [PF04717], Evalue: 3.90E-18, Aligned region: 445..543
Sarcoglycan_1 [PF04790], Evalue: 0.0003, Aligned region: 195..252
Sarcoglycan_1 [PF04790], Evalue: 0.0003, Aligned region: 705..758
Sarcoglycan_1 [PF04790], Evalue: 0.0003, Aligned region: 774..825
Protein Sequence: 875 a.a.     [Download]
>gi|299770695|ref|YP_003732721.1| hypothetical protein AOLE_12305 [Acinetobacter oleivorans DR1]
MLSHIHRILEDLGISSQKRVLHVQFSNPSLNTQVFLQSIEGQHQLNEGLTADLFCLSTNAHISLKQFIGC
QVAVDQVTDQGQLYRTTGIITEASQGQSDGSLTLYKLRLQDPTALWHKRRNSRVFMNKSVRDITEILFTE
WQNKSPLFASGLTLDLKNLSQDYDVRPFVMQSNETDYEFLTRLWRSEGINWLVDEAQLWAADSSDEIQSQ
KLRLIDSNESYLALDRRNIRYHRSSAVEQQDSMTSLVPTRSLQSTAVHVQRWQADALSQEEGMGSVQSKH
SHSANQDNASLSLEHAWHVSPAWMQDLKGEDQATASGHQQLEKLNNNLSDYYASQSKYFRAQTTVRDTQV
GYWFELDEHPEIDTHSGSDKEFLIVGKSFYLQNNLPKDLQQQINQLFSQSQWQNYQSGLNDQTERQINEL
ILSRRNIKTVPEYHPLEHRPAAYPQRARVVGLEGESIHVDQWGRIKVRFLFTRTDDHSHDGGAGSNDNDT
DSAWVDVLTPWAGEGYGARFLPRVGEIVVIDFFDGNIDRPFVVGRIHEAERHPTQFDQKGQLPDTKKLSG
IRSEEVDGKGFNQLRFDDTTGQISAQLQSSHAVSQLNLGNLSHPKDKAESEGRGEGFEIRTDQWGAVRAG
SGLLLSTHKQNQAQGLHLDANEAKQQIEGSLNNAKALSEVAKNQQTDPLDMLENIQTFLEALKQEDPKKA
AEFQSAVMLLASPKSIAVSSNEDIHLSANGQLTQSAGDSINISTQKNIVSHASQKISLFAAQEGARLFAG
QGKVEIQAQGDGLDVIARKGVQITSTEDTVFITSPTEINLTANGSQVKLNGSGIFPVTGGKLEVKAGQHL
FMGGSSINPPALDLPDCSAKQSDAAKNGSAKVILD
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|299768250|ref|NC_014259.1|:c2647438-2644811 Acinetobacter oleivorans DR1 chromosome, complete genome
ATGTTATCTCATATACATAGAATTCTAGAAGATTTGGGTATCAGCTCGCAAAAACGCGTGCTTCATGTTC
AGTTTTCTAATCCATCGTTGAATACTCAAGTCTTTTTACAAAGTATTGAAGGGCAGCATCAGTTAAATGA
AGGACTGACTGCCGATTTATTTTGTCTTTCTACCAATGCCCATATTTCATTAAAACAATTTATTGGATGT
CAGGTTGCAGTCGATCAAGTAACTGATCAGGGGCAGTTATATAGAACTACCGGAATTATTACCGAAGCCA
GTCAGGGGCAGAGTGATGGTTCATTAACATTGTATAAACTGAGATTACAAGATCCGACCGCGCTATGGCA
TAAACGCCGAAATAGCCGTGTTTTTATGAATAAAAGTGTACGGGACATTACTGAAATTCTATTTACTGAG
TGGCAGAACAAAAGCCCGTTGTTTGCTTCTGGCTTAACTTTAGATTTAAAAAACCTAAGCCAAGACTACG
ATGTTCGACCTTTTGTCATGCAAAGTAACGAAACGGATTATGAGTTTTTAACTCGACTTTGGCGTAGTGA
AGGCATTAACTGGTTGGTTGATGAAGCTCAGCTTTGGGCCGCTGATAGCTCGGATGAGATTCAATCACAA
AAGTTACGTTTAATTGATAGTAATGAATCATATTTAGCATTAGACCGAAGAAATATCCGTTATCACCGCA
GTAGCGCAGTTGAACAACAAGACAGTATGACGAGTCTTGTGCCAACTCGAAGCTTGCAATCTACAGCCGT
GCATGTACAACGCTGGCAGGCTGATGCTTTAAGTCAAGAAGAAGGCATGGGCAGTGTTCAGTCAAAGCAT
AGCCATAGTGCTAATCAGGATAATGCGAGTTTAAGTCTAGAACATGCATGGCATGTCAGCCCTGCTTGGA
TGCAAGATTTAAAAGGTGAAGATCAAGCTACCGCATCGGGTCACCAGCAGCTAGAAAAACTCAACAATAA
TCTATCTGATTATTATGCGTCTCAATCAAAATATTTCCGTGCACAAACTACGGTACGTGATACGCAAGTT
GGCTATTGGTTTGAATTGGATGAACATCCTGAAATAGATACGCATAGTGGATCAGACAAAGAGTTTCTGA
TTGTTGGGAAAAGCTTCTATCTGCAAAATAATTTGCCTAAAGATTTGCAACAGCAAATCAATCAACTTTT
TAGTCAAAGCCAATGGCAAAACTATCAATCAGGGCTAAATGACCAGACTGAGCGTCAGATTAATGAGCTC
ATCTTGTCGCGTAGAAATATTAAAACTGTTCCTGAGTATCATCCGTTAGAGCACCGTCCAGCTGCTTACC
CGCAGCGCGCTAGAGTGGTGGGCTTGGAAGGCGAAAGTATCCATGTTGACCAATGGGGGCGCATTAAAGT
TCGCTTCCTATTTACCCGAACTGACGACCATAGCCATGATGGTGGTGCAGGAAGTAACGATAATGATACT
GATTCGGCTTGGGTCGATGTATTAACCCCATGGGCAGGTGAGGGTTATGGCGCACGTTTCTTGCCTCGCG
TGGGCGAGATCGTGGTGATCGACTTCTTTGACGGCAACATTGATCGCCCGTTTGTGGTGGGTCGTATTCA
TGAGGCTGAACGTCACCCAACGCAATTCGACCAAAAAGGCCAACTACCCGACACTAAAAAGCTCAGTGGT
ATCCGCTCAGAAGAAGTCGACGGCAAAGGCTTTAACCAGCTACGTTTTGATGACACCACAGGCCAGATCA
GTGCCCAGCTACAAAGTAGCCATGCGGTAAGCCAACTAAACTTGGGTAACTTAAGCCATCCAAAAGATAA
GGCGGAGAGTGAAGGTCGTGGTGAGGGTTTTGAAATCAGAACAGACCAGTGGGGTGCAGTAAGAGCAGGC
AGTGGTTTACTCCTTAGTACCCACAAGCAAAATCAAGCTCAAGGCCTACACCTCGATGCAAATGAGGCCA
AACAACAAATAGAAGGCAGCCTAAATAATGCTAAGGCACTCAGTGAAGTTGCTAAAAATCAGCAAACCGA
CCCGTTAGATATGCTTGAGAATATTCAGACTTTCTTAGAAGCTCTCAAACAAGAAGATCCTAAAAAAGCT
GCTGAGTTTCAATCAGCAGTGATGCTGCTGGCATCTCCAAAAAGTATTGCTGTAAGTAGTAATGAAGATA
TACACCTTAGTGCAAATGGACAGCTCACTCAAAGTGCTGGAGATAGTATTAATATTAGTACGCAAAAGAA
TATAGTGAGTCATGCGAGTCAAAAAATAAGTCTGTTTGCCGCGCAAGAAGGTGCTCGGCTTTTTGCTGGT
CAAGGTAAAGTTGAAATTCAGGCACAAGGTGATGGCTTAGATGTGATTGCTCGAAAGGGCGTACAGATTA
CGTCAACCGAAGACACGGTTTTTATTACTAGTCCAACTGAAATTAATCTGACTGCAAATGGGTCTCAAGT
AAAGCTAAATGGTTCAGGTATTTTCCCTGTTACGGGCGGTAAGCTTGAGGTGAAAGCAGGGCAGCATTTG
TTTATGGGGGGCTCATCAATAAATCCACCTGCATTAGATTTACCAGACTGTTCTGCTAAACAGTCAGATG
CAGCAAAAAATGGATCAGCAAAAGTGATATTAGACTAA