SecReT6
Protein ID: 299770702
SecReT6 ID400
T6SS typei4b
Gene symbol-
Locus tagAOLE_12340
StrainAcinetobacter oleivorans DR1
Repliconchromosome [GenBank: NC_014259] [Browse all T6SS(s) in this replicon]
Location [Strand]2653017..2655914 [-]
Producthypothetical protein
NoteTssI
UniProt IDD8JMN0
KEGG IDacd:AOLE_12340
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.10E-54, Aligned region: 45..384
Phage_GPD [PF05954], Evalue: 8.10E-54, Aligned region: 636..683
DUF2345 [PF10106], Evalue: 1.30E-48, Aligned region: 694..845
T6SS_Vgr [PF13296], Evalue: 4.70E-39, Aligned region: 563..671
T6SS_Vgr [PF13296], Evalue: 4.70E-39, Aligned region: 726..752
Phage_base_V [PF04717], Evalue: 7.20E-18, Aligned region: 445..543
Protein Sequence: 965 a.a.     [Download]
>gi|299770702|ref|YP_003732728.1| hypothetical protein AOLE_12340 [Acinetobacter oleivorans DR1]
MSHKIFQILDSLGLVAQNRVLHVQFSNPSLNNQVFLQRIEGEHTLNQGSVAELLCLSTNAHIALKQFIGC
QVAVDQVTDTGQFFRTTGIITEASQGQSDGSLTIYNLTLKDPTALWHKRRNSRVFMNKSVRDISEILFKE
WQGKSPLFASSLTLDTAGLTKDYDVRPFVMQSNESDYDFLTRLWRSEGISWLVDESQLLVADPNASIQPQ
VLRLIDENQNYKALERRSLRYQRSSATEQFDTITQVKAERRLQPTSVHVQRWQADALQQEEGSGSVQGTQ
KHSEHYDNASLNLEDAWHVSPAWMQDLKGEDQATASGNSQIEQLNQHINAYHHLSSKQFTVSGNVRDAQV
GYWFELNDHPELDQHDSADKEFLILSKHYYNQNNLPKELQQQLERLLPKDKLKAAQLDNQNPEQRHYAEL
NVVRRNIKAVPEYNPLEHRPAAYPQRARVVGLEGESIHVDQWGRIKVRFLFTRADDHSHDGGAGSNDNDT
DSAWVDVLTPWAGAGYGARFLPRVGEIVVIDFFDGNIDRPFVVGRIHEAERHPTQFDQKGQLPDTKKLSG
IRSEEVDGKGFNQLRFDDTTGQISAQLQSSHAASQLNLGNLSHPKDKAESDGRGEGFELRTDQWGAVRAG
SGLLVSTHKQDQAQGVHLDANEAKQQIEGGLNNAKALSEVAKNQQTDPLEVLENLKTFIEQIEEKDQDKA
AAFKQALMILTAPNSIALASNEDIHLSADAQLSQTAGDSINLSTQKNLIAHAQNKISLFAAQEGARLYAG
KGKVEIQAQGDGADLIARKAVQIISTEDKIEISASKEIVITAGGSQIKINGSGIFPVTGGKFEVKAGQHL
FMGGGSAQSQNIGLPLLGKLNNWMELNYHYDDLSPVKGAPFKVFFEDGSYREGVLDSKGYAKLENIPSGK
SEIYYGEDPSEFIKDEPDDLDAVIEDDDQLEDDLWSFLDEDSYKKLTSDLQKGSK
 
Nucleotide Sequence: 2898 bp     [Download]
>gi|299768250|ref|NC_014259.1|:c2655914-2653017 Acinetobacter oleivorans DR1 chromosome, complete genome
ATGTCCCATAAAATATTTCAAATTTTAGATAGTTTAGGTTTGGTCGCACAGAATCGTGTACTTCATGTGC
AATTTTCCAACCCATCATTAAACAATCAAGTCTTCTTACAACGTATTGAAGGCGAACATACGCTTAATCA
GGGCAGCGTTGCTGAGCTACTGTGTCTGTCGACGAACGCGCATATTGCATTAAAACAATTTATTGGCTGT
CAGGTGGCCGTAGATCAAGTCACTGACACAGGCCAGTTCTTTAGAACCACAGGTATTATTACAGAAGCAA
GCCAAGGGCAAAGCGACGGCTCACTCACCATTTATAATTTAACCTTAAAAGATCCAACTGCACTCTGGCA
TAAACGCCGCAATAGCCGAGTGTTTATGAATAAAAGCGTGCGAGATATTAGCGAAATTCTGTTTAAAGAA
TGGCAGGGGAAAAGTCCGTTATTTGCCTCAAGTCTAACGCTCGACACAGCAGGTTTAACGAAGGACTACG
ATGTGCGTCCATTTGTGATGCAGTCAAACGAAAGCGATTATGACTTTTTAACCCGTCTGTGGCGTAGCGA
AGGCATTAGTTGGTTAGTCGATGAATCTCAGCTTTTAGTAGCGGATCCGAATGCGTCTATTCAGCCACAA
GTGCTACGTTTGATTGATGAAAATCAGAATTATAAAGCTCTTGAACGCCGTAGCCTCCGTTACCAACGCA
GCAGTGCCACAGAACAGTTTGATACCATTACCCAAGTTAAAGCTGAGCGCCGCTTACAACCGACTTCAGT
TCATGTGCAACGCTGGCAAGCCGATGCCCTACAACAAGAAGAAGGTAGCGGCAGTGTACAAGGCACGCAA
AAGCACAGTGAACACTATGACAATGCAAGCTTGAATCTTGAAGATGCATGGCACGTTAGCCCAGCTTGGA
TGCAGGACTTAAAGGGTGAAGACCAAGCCACCGCTTCTGGTAATAGCCAGATTGAACAGCTTAACCAGCA
TATTAATGCTTATCATCACCTGAGTTCTAAACAGTTTACGGTTTCAGGTAATGTCCGTGATGCACAGGTC
GGTTATTGGTTTGAACTGAATGACCACCCAGAACTCGATCAACATGACAGCGCTGATAAAGAATTTTTAA
TCTTAAGTAAGCACTACTATAACCAGAATAATTTACCGAAAGAATTACAGCAGCAACTCGAACGCTTGTT
GCCAAAAGACAAACTCAAGGCCGCTCAACTCGATAACCAAAACCCAGAGCAGCGCCACTATGCTGAGCTG
AATGTCGTTCGACGCAATATTAAAGCTGTCCCTGAATATAACCCGCTAGAACACCGACCAGCAGCTTACC
CGCAGCGTGCTAGAGTAGTTGGGTTAGAGGGCGAAAGCATTCATGTCGATCAGTGGGGACGCATTAAAGT
CCGTTTCTTGTTTACCCGAGCTGATGACCATAGCCATGACGGTGGAGCGGGAAGTAACGACAATGACACT
GACTCGGCTTGGGTCGATGTGCTGACCCCATGGGCAGGCGCAGGTTATGGTGCACGCTTCTTGCCTCGAG
TGGGTGAGATCGTGGTGATCGATTTCTTTGACGGCAACATTGACCGTCCATTTGTGGTGGGGCGTATTCA
CGAAGCTGAACGCCACCCAACCCAGTTCGATCAGAAAGGCCAATTACCTGATACTAAAAAACTCAGTGGT
ATCCGCTCAGAAGAAGTCGACGGTAAGGGCTTTAACCAGCTACGCTTTGATGACACCACAGGGCAAATCA
GTGCCCAGCTACAAAGTAGTCATGCAGCAAGCCAGCTCAACTTAGGTAACTTAAGCCATCCAAAAGATAA
GGCGGAAAGTGATGGTCGAGGTGAAGGTTTTGAACTTAGAACAGATCAGTGGGGTGCAGTAAGAGCTGGT
AGTGGCTTACTCGTTAGTACCCATAAACAGGACCAAGCTCAAGGCGTACACCTAGATGCAAATGAGGCCA
AACAACAAATAGAAGGTGGCCTTAACAATGCCAAGGCACTCAGTGAAGTAGCTAAAAATCAGCAAACTGA
TCCATTGGAAGTTCTTGAGAACTTAAAAACGTTCATAGAACAAATTGAAGAAAAAGATCAAGACAAAGCT
GCCGCTTTTAAGCAAGCCTTGATGATATTAACTGCACCTAACAGTATCGCTTTAGCCAGTAATGAAGACA
TTCACCTAAGCGCAGATGCTCAGTTAAGCCAAACTGCGGGCGATAGTATTAACCTGTCTACACAAAAGAA
CTTGATTGCACACGCCCAAAATAAAATCAGCCTTTTTGCAGCTCAAGAAGGGGCGAGACTCTATGCAGGC
AAAGGCAAAGTCGAAATACAAGCACAAGGCGATGGAGCAGATTTAATTGCCCGTAAAGCTGTTCAGATTA
TTTCAACAGAAGACAAAATTGAAATTAGTGCTTCTAAAGAAATCGTTATCACGGCGGGCGGATCTCAAAT
CAAGATTAATGGTTCAGGAATTTTCCCTGTCACTGGTGGCAAGTTTGAGGTAAAAGCTGGGCAGCATTTA
TTTATGGGGGGAGGAAGTGCGCAAAGTCAGAATATAGGTCTTCCCTTATTAGGTAAATTAAATAATTGGA
TGGAACTTAATTATCATTATGATGATTTATCTCCAGTTAAAGGTGCGCCATTTAAAGTTTTTTTTGAAGA
TGGTAGTTATAGAGAGGGAGTCTTAGATAGCAAAGGATACGCAAAATTAGAAAATATTCCTTCTGGTAAA
TCAGAAATCTATTATGGAGAGGATCCTTCTGAGTTTATTAAAGATGAGCCAGATGATTTAGATGCTGTAA
TTGAAGATGACGATCAATTAGAAGATGATTTATGGTCATTTCTAGATGAAGATAGTTATAAAAAATTAAC
ATCTGATTTACAAAAGGGGAGTAAATAA