SecReT6
Protein ID: 300310071
SecReT6 ID405
T6SS typei4b
Gene symbol-
Locus tagHsero_0736
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]803061..805925 [-]
ProductVGR-related protein
NoteTssI
UniProt IDD8IZD5
KEGG IDhse:Hsero_0736
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.80E-67, Aligned region: 50..367
Phage_GPD [PF05954], Evalue: 5.80E-67, Aligned region: 743..826
Phage_GPD [PF05954], Evalue: 5.80E-67, Aligned region: 739..826
DUF2345 [PF10106], Evalue: 9.50E-48, Aligned region: 723..875
T6SS_Vgr [PF13296], Evalue: 7.00E-34, Aligned region: 561..674
Phage_base_V [PF04717], Evalue: 1.10E-19, Aligned region: 429..540
Sarcoglycan_1 [PF04790], Evalue: 0.0027, Aligned region: 801..855
Protein Sequence: 954 a.a.     [Download]
>gi|300310071|ref|YP_003774163.1| VGR-related protein [Herbaspirillum seropedicae SmR1]
MNLPLPDSLTAAVTELFGTGLSQNARLITMTTAQSAGLPETLAVERFEGEESVNDNFRFDIDALSISTDL
DLKQFIGAEISLRLLQADGGTRAWHGYCTQASWLGADGGLARYRLRLESFLAFLDRRHDSFLFQDMTVTD
IAAAVLKEYPQANFSLEVTQTLAKRDICTQYRETDYAFLRRILASEGLNFRFEHEQDDATQQHDQSQPHA
RHKLVIFDRNAKAPALPGGDEYIRFHRVAAMEASDAITDFAAVRSVRPNGVALASWHPEKLSSPSHEEGS
TLDAGELPSLPVYDGTGQQDFADQDAAAAHAQLMLQALEMQNKRFEGAGAARQLAAGARFTLLQHERYPE
GENAFKVVSVRHAARNNVSANITRILAPAAGALFGGSAAAERDDDLQAGTYRNSFTAIRDSVPMVPAAIA
ERLKPTARGTQTALVTGAADAAVTTDRNHRVKVQFHWQRGKSPNPGGLRETGNLDDKDGNANGNDSSGTW
IRVAEAQSGPNWGSQFIPRVGSEVLVDFIEGDIDRPVVVAQLYNGSDAPPFPAGADSGINHAGSISGWHS
TAHDGSGFNQWVVDDTQSQLRMRLASSTAKSQLNLGHLVEQADTGAQRGSYRGQGFELRSDAWGVVRGGE
GLLLSTTARPLNGASVTGTQMDAAGAIAQLKGAKSLAQTMSDSATQQQALSSTQALQAKTDFLALIDPSD
QGKHPASVNGQDALKSDGSTRNTDAAQPVEKFAKAAVLMDSPSSINWTSNASTLLYAAENLQWTTQGDVH
WSAADTASAAAGKAASFYSHDGGIQAFAANGPVSLQAHTDALEILADKDVTVTSVNDSIEIKARQKIVLQ
AGQASVTLEGGNITFACPGTFSVKGATHAFPGGASVSPDLMALPDTKYKLFDEAFVVKDPNGTPLSDIPY
RIKSSAGDQLATTAKDGMSERVSTEASENVEFAMEWFKVVPAKT
 
Nucleotide Sequence: 2865 bp     [Download]
>gi|300309346|ref|NC_014323.1|:c805925-803061 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGAACCTGCCACTGCCCGATTCGCTCACCGCCGCCGTCACTGAATTGTTTGGTACCGGCCTGTCGCAGA
ACGCCCGCCTCATCACCATGACCACGGCGCAGTCCGCAGGCCTGCCCGAGACGCTGGCGGTAGAACGCTT
CGAGGGCGAGGAAAGCGTCAATGACAACTTCCGCTTCGACATCGATGCGCTGTCCATCTCCACCGACCTC
GACCTGAAACAGTTCATCGGCGCCGAGATCAGCCTGCGGCTGTTGCAGGCCGATGGCGGCACGCGCGCCT
GGCATGGCTACTGCACCCAGGCCTCGTGGCTGGGCGCTGATGGCGGGCTGGCGCGCTACCGGCTGCGCTT
GGAATCCTTCCTGGCCTTCCTGGATCGCCGCCATGACAGCTTCCTGTTCCAGGACATGACCGTCACCGAT
ATTGCAGCAGCCGTGCTCAAGGAATACCCGCAGGCCAATTTCTCGCTGGAGGTGACGCAGACGCTGGCCA
AGCGCGACATCTGCACGCAGTATCGCGAGACCGACTACGCCTTCCTGCGCCGTATCCTGGCCTCCGAAGG
CCTGAACTTCCGCTTCGAGCACGAACAGGACGACGCCACGCAGCAGCACGACCAGTCGCAGCCGCATGCC
CGCCACAAGCTGGTGATCTTCGACCGCAACGCCAAGGCGCCGGCACTGCCCGGTGGCGATGAGTACATCC
GTTTCCATCGGGTGGCGGCCATGGAAGCCAGCGATGCCATCACCGACTTTGCCGCCGTGCGCAGCGTGCG
CCCCAACGGCGTGGCGCTGGCCAGCTGGCATCCGGAGAAGCTCTCGTCTCCCTCGCATGAGGAGGGCTCG
ACCCTGGATGCCGGAGAACTCCCGTCCCTGCCAGTCTACGACGGCACCGGTCAGCAGGACTTCGCCGACC
AGGACGCTGCCGCCGCCCATGCCCAGCTGATGCTGCAGGCGCTGGAGATGCAGAACAAGCGTTTCGAGGG
CGCAGGCGCGGCGCGCCAACTGGCGGCAGGAGCGCGCTTCACGCTGCTGCAGCACGAGCGCTATCCCGAG
GGTGAGAACGCCTTCAAGGTCGTGAGCGTGCGCCATGCGGCGCGCAACAATGTCAGCGCCAACATCACCC
GCATCCTCGCACCGGCGGCAGGCGCGCTCTTTGGCGGCAGCGCTGCGGCCGAGCGCGATGACGACCTGCA
GGCCGGGACCTACCGCAACAGCTTCACGGCCATCCGCGACAGCGTACCCATGGTGCCGGCGGCCATCGCC
GAGCGCCTCAAGCCCACTGCCCGCGGCACGCAGACGGCGCTGGTCACGGGCGCGGCCGATGCGGCGGTCA
CGACCGACCGCAACCACCGCGTGAAGGTGCAATTCCACTGGCAGCGCGGCAAGTCGCCCAATCCTGGCGG
GCTCAGGGAGACCGGCAATCTGGACGACAAGGACGGCAACGCCAACGGCAACGACAGTTCCGGCACCTGG
ATCCGCGTGGCCGAGGCGCAGTCCGGACCCAACTGGGGCAGCCAGTTCATCCCGCGCGTAGGCAGCGAGG
TGCTGGTCGATTTCATCGAAGGCGATATCGATCGTCCGGTGGTCGTGGCCCAGCTCTACAATGGCAGCGA
TGCGCCGCCCTTCCCGGCCGGCGCTGATTCCGGCATCAACCATGCAGGCAGCATCTCTGGCTGGCACAGC
ACCGCCCATGACGGCAGCGGATTCAACCAGTGGGTAGTGGACGATACCCAGTCGCAGTTGCGCATGCGCC
TTGCCTCCAGCACGGCCAAGTCACAGTTGAACCTGGGGCACCTGGTGGAACAGGCCGATACCGGCGCCCA
GCGCGGCAGCTACCGGGGCCAGGGTTTCGAATTGCGCAGCGATGCCTGGGGCGTGGTGCGCGGCGGCGAA
GGCCTGCTGCTCTCCACCACCGCGCGCCCACTCAACGGCGCCAGCGTAACTGGCACGCAGATGGATGCGG
CTGGCGCCATTGCGCAGCTCAAGGGAGCGAAGTCGCTGGCCCAGACGATGAGCGACTCTGCCACGCAGCA
GCAAGCCCTCAGCAGCACCCAGGCGCTGCAGGCCAAGACCGATTTCCTGGCGCTGATCGATCCCAGTGAT
CAGGGCAAGCATCCGGCCAGCGTGAATGGCCAGGACGCGCTCAAGTCCGACGGCAGCACACGCAATACCG
ACGCCGCGCAGCCGGTGGAAAAATTCGCCAAGGCTGCCGTGCTGATGGATTCCCCCTCCAGCATCAACTG
GACCAGTAACGCCTCCACCTTGCTGTATGCCGCAGAGAACCTGCAATGGACCACCCAGGGCGACGTCCAC
TGGAGCGCCGCCGACACGGCCAGCGCCGCCGCCGGCAAAGCGGCCAGCTTCTACAGCCATGATGGCGGCA
TCCAGGCCTTCGCCGCCAATGGACCGGTTTCGCTGCAGGCCCATACCGACGCCCTGGAGATCCTGGCGGA
CAAGGATGTGACTGTTACCAGCGTCAACGACAGCATCGAGATCAAGGCGCGTCAGAAGATCGTGTTGCAG
GCAGGACAGGCTTCGGTGACGCTGGAGGGCGGGAATATTACCTTTGCTTGTCCGGGGACGTTTTCGGTGA
AGGGGGCGACGCATGCGTTTCCGGGGGGAGCGAGCGTCTCTCCGGATCTGATGGCGCTGCCAGACACCAA
GTACAAGCTCTTCGACGAAGCCTTCGTGGTGAAGGACCCCAATGGGACTCCACTCTCTGACATCCCTTAT
CGGATCAAGAGTTCAGCCGGAGACCAGCTGGCGACCACCGCCAAGGACGGCATGAGCGAGCGCGTTAGCA
CGGAAGCCAGCGAGAACGTGGAGTTCGCCATGGAGTGGTTCAAGGTCGTGCCGGCCAAAACTTGA