SecReT6
Protein ID: 300310071
SecReT6 ID405
T6SS typei4b
Gene symbol-
Locus tagHsero_0736
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]803061..805925 [-]
ProductVGR-related protein
NoteTssI
UniProt IDD8IZD5
KEGG IDhse:Hsero_0736
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.80E-67, Aligned region: 50..367
Phage_GPD [PF05954], Evalue: 5.80E-67, Aligned region: 743..826
Phage_GPD [PF05954], Evalue: 5.80E-67, Aligned region: 739..826
DUF2345 [PF10106], Evalue: 9.50E-48, Aligned region: 723..875
T6SS_Vgr [PF13296], Evalue: 7.00E-34, Aligned region: 561..674
Phage_base_V [PF04717], Evalue: 1.10E-19, Aligned region: 429..540
Sarcoglycan_1 [PF04790], Evalue: 0.0027, Aligned region: 801..855
Protein Sequence: 954 a.a.     [Download]
>gi|300310071|ref|YP_003774163.1| VGR-related protein [Herbaspirillum seropedicae SmR1]
MNLPLPDSLTAAVTELFGTGLSQNARLITMTTAQSAGLPETLAVERFEGEESVNDNFRFDIDALSISTDL
DLKQFIGAEISLRLLQADGGTRAWHGYCTQASWLGADGGLARYRLRLESFLAFLDRRHDSFLFQDMTVTD
IAAAVLKEYPQANFSLEVTQTLAKRDICTQYRETDYAFLRRILASEGLNFRFEHEQDDATQQHDQSQPHA
RHKLVIFDRNAKAPALPGGDEYIRFHRVAAMEASDAITDFAAVRSVRPNGVALASWHPEKLSSPSHEEGS
TLDAGELPSLPVYDGTGQQDFADQDAAAAHAQLMLQALEMQNKRFEGAGAARQLAAGARFTLLQHERYPE
GENAFKVVSVRHAARNNVSANITRILAPAAGALFGGSAAAERDDDLQAGTYRNSFTAIRDSVPMVPAAIA
ERLKPTARGTQTALVTGAADAAVTTDRNHRVKVQFHWQRGKSPNPGGLRETGNLDDKDGNANGNDSSGTW
IRVAEAQSGPNWGSQFIPRVGSEVLVDFIEGDIDRPVVVAQLYNGSDAPPFPAGADSGINHAGSISGWHS
TAHDGSGFNQWVVDDTQSQLRMRLASSTAKSQLNLGHLVEQADTGAQRGSYRGQGFELRSDAWGVVRGGE
GLLLSTTARPLNGASVTGTQMDAAGAIAQLKGAKSLAQTMSDSATQQQALSSTQALQAKTDFLALIDPSD
QGKHPASVNGQDALKSDGSTRNTDAAQPVEKFAKAAVLMDSPSSINWTSNASTLLYAAENLQWTTQGDVH
WSAADTASAAAGKAASFYSHDGGIQAFAANGPVSLQAHTDALEILADKDVTVTSVNDSIEIKARQKIVLQ
AGQASVTLEGGNITFACPGTFSVKGATHAFPGGASVSPDLMALPDTKYKLFDEAFVVKDPNGTPLSDIPY
RIKSSAGDQLATTAKDGMSERVSTEASENVEFAMEWFKVVPAKT
 
Nucleotide Sequence: 2865 bp     [Download]
>gi|300309346|ref|NC_014323.1|:c805925-803061 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGAACCTGCCACTGCCCGATTCGCTCACCGCCGCCGTCACTGAATTGTTTGGTACCGGCCTGTCGCAGA
ACGCCCGCCTCATCACCATGACCACGGCGCAGTCCGCAGGCCTGCCCGAGACGCTGGCGGTAGAACGCTT
CGAGGGCGAGGAAAGCGTCAATGACAACTTCCGCTTCGACATCGATGCGCTGTCCATCTCCACCGACCTC
GACCTGAAACAGTTCATCGGCGCCGAGATCAGCCTGCGGCTGTTGCAGGCCGATGGCGGCACGCGCGCCT
GGCATGGCTACTGCACCCAGGCCTCGTGGCTGGGCGCTGATGGCGGGCTGGCGCGCTACCGGCTGCGCTT
GGAATCCTTCCTGGCCTTCCTGGATCGCCGCCATGACAGCTTCCTGTTCCAGGACATGACCGTCACCGAT
ATTGCAGCAGCCGTGCTCAAGGAATACCCGCAGGCCAATTTCTCGCTGGAGGTGACGCAGACGCTGGCCA
AGCGCGACATCTGCACGCAGTATCGCGAGACCGACTACGCCTTCCTGCGCCGTATCCTGGCCTCCGAAGG
CCTGAACTTCCGCTTCGAGCACGAACAGGACGACGCCACGCAGCAGCACGACCAGTCGCAGCCGCATGCC
CGCCACAAGCTGGTGATCTTCGACCGCAACGCCAAGGCGCCGGCACTGCCCGGTGGCGATGAGTACATCC
GTTTCCATCGGGTGGCGGCCATGGAAGCCAGCGATGCCATCACCGACTTTGCCGCCGTGCGCAGCGTGCG
CCCCAACGGCGTGGCGCTGGCCAGCTGGCATCCGGAGAAGCTCTCGTCTCCCTCGCATGAGGAGGGCTCG
ACCCTGGATGCCGGAGAACTCCCGTCCCTGCCAGTCTACGACGGCACCGGTCAGCAGGACTTCGCCGACC
AGGACGCTGCCGCCGCCCATGCCCAGCTGATGCTGCAGGCGCTGGAGATGCAGAACAAGCGTTTCGAGGG
CGCAGGCGCGGCGCGCCAACTGGCGGCAGGAGCGCGCTTCACGCTGCTGCAGCACGAGCGCTATCCCGAG
GGTGAGAACGCCTTCAAGGTCGTGAGCGTGCGCCATGCGGCGCGCAACAATGTCAGCGCCAACATCACCC
GCATCCTCGCACCGGCGGCAGGCGCGCTCTTTGGCGGCAGCGCTGCGGCCGAGCGCGATGACGACCTGCA
GGCCGGGACCTACCGCAACAGCTTCACGGCCATCCGCGACAGCGTACCCATGGTGCCGGCGGCCATCGCC
GAGCGCCTCAAGCCCACTGCCCGCGGCACGCAGACGGCGCTGGTCACGGGCGCGGCCGATGCGGCGGTCA
CGACCGACCGCAACCACCGCGTGAAGGTGCAATTCCACTGGCAGCGCGGCAAGTCGCCCAATCCTGGCGG
GCTCAGGGAGACCGGCAATCTGGACGACAAGGACGGCAACGCCAACGGCAACGACAGTTCCGGCACCTGG
ATCCGCGTGGCCGAGGCGCAGTCCGGACCCAACTGGGGCAGCCAGTTCATCCCGCGCGTAGGCAGCGAGG
TGCTGGTCGATTTCATCGAAGGCGATATCGATCGTCCGGTGGTCGTGGCCCAGCTCTACAATGGCAGCGA
TGCGCCGCCCTTCCCGGCCGGCGCTGATTCCGGCATCAACCATGCAGGCAGCATCTCTGGCTGGCACAGC
ACCGCCCATGACGGCAGCGGATTCAACCAGTGGGTAGTGGACGATACCCAGTCGCAGTTGCGCATGCGCC
TTGCCTCCAGCACGGCCAAGTCACAGTTGAACCTGGGGCACCTGGTGGAACAGGCCGATACCGGCGCCCA
GCGCGGCAGCTACCGGGGCCAGGGTTTCGAATTGCGCAGCGATGCCTGGGGCGTGGTGCGCGGCGGCGAA
GGCCTGCTGCTCTCCACCACCGCGCGCCCACTCAACGGCGCCAGCGTAACTGGCACGCAGATGGATGCGG
CTGGCGCCATTGCGCAGCTCAAGGGAGCGAAGTCGCTGGCCCAGACGATGAGCGACTCTGCCACGCAGCA
GCAAGCCCTCAGCAGCACCCAGGCGCTGCAGGCCAAGACCGATTTCCTGGCGCTGATCGATCCCAGTGAT
CAGGGCAAGCATCCGGCCAGCGTGAATGGCCAGGACGCGCTCAAGTCCGACGGCAGCACACGCAATACCG
ACGCCGCGCAGCCGGTGGAAAAATTCGCCAAGGCTGCCGTGCTGATGGATTCCCCCTCCAGCATCAACTG
GACCAGTAACGCCTCCACCTTGCTGTATGCCGCAGAGAACCTGCAATGGACCACCCAGGGCGACGTCCAC
TGGAGCGCCGCCGACACGGCCAGCGCCGCCGCCGGCAAAGCGGCCAGCTTCTACAGCCATGATGGCGGCA
TCCAGGCCTTCGCCGCCAATGGACCGGTTTCGCTGCAGGCCCATACCGACGCCCTGGAGATCCTGGCGGA
CAAGGATGTGACTGTTACCAGCGTCAACGACAGCATCGAGATCAAGGCGCGTCAGAAGATCGTGTTGCAG
GCAGGACAGGCTTCGGTGACGCTGGAGGGCGGGAATATTACCTTTGCTTGTCCGGGGACGTTTTCGGTGA
AGGGGGCGACGCATGCGTTTCCGGGGGGAGCGAGCGTCTCTCCGGATCTGATGGCGCTGCCAGACACCAA
GTACAAGCTCTTCGACGAAGCCTTCGTGGTGAAGGACCCCAATGGGACTCCACTCTCTGACATCCCTTAT
CGGATCAAGAGTTCAGCCGGAGACCAGCTGGCGACCACCGCCAAGGACGGCATGAGCGAGCGCGTTAGCA
CGGAAGCCAGCGAGAACGTGGAGTTCGCCATGGAGTGGTTCAAGGTCGTGCCGGCCAAAACTTGA

Protein ID: 300310083
SecReT6 ID405
T6SS typei4b
Gene symbolvgr
Locus tagHsero_0748
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]818820..821654 [+]
ProductVGR-related type VI secretion system protein
NoteTssI
UniProt IDD8IZE7
KEGG IDhse:Hsero_0748
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-70, Aligned region: 62..372
Phage_GPD [PF05954], Evalue: 1.70E-70, Aligned region: 612..730
DUF2345 [PF10106], Evalue: 3.20E-37, Aligned region: 655..730
DUF2345 [PF10106], Evalue: 3.20E-37, Aligned region: 758..922
T6SS_Vgr [PF13296], Evalue: 3.10E-22, Aligned region: 607..712
T6SS_Vgr [PF13296], Evalue: 3.10E-22, Aligned region: 855..870
Phage_base_V [PF04717], Evalue: 8.70E-16, Aligned region: 352..371
Phage_base_V [PF04717], Evalue: 8.70E-16, Aligned region: 448..556
Protein Sequence: 944 a.a.     [Download]
>gi|300310083|ref|YP_003774175.1| VGR-related type VI secretion system protein [Herbaspirillum seropedicae SmR1]
MNLSDLPALFGAWSQSARVMRLHTPLDQDYGPHALMAERLQAVEQVGPGEDSSAIDQAIAGYRLQLSCLS
LNADISLRKLLGQPVLLELDTDGGARAFHGHVTACRMEGANGGMARYLLTIEPWLSFLRHRRDSAVFQDM
SAPAIIEAVFADYRGQGRLQPAWRLDLQDASAYAKRSLATQYQETDLAFVTRLMVEEGLFYYIEHQGDSN
SASLGSHTVVIADHNGSFKPNARSTVAFAQTNAVMAQDNIDRWRSVRRWQTNAVEILTWDYRQTAVRAAS
TASSGENAHDKLVLTSRDAPGQYINESPEQAQRQALNQMQAIEVRNKVFTGAGTVRSFLPGTTFTLTGHY
DHDGGDDDQFVLLRVVHQAHNNLSADLKAGVTALLGQAQLDDHDHKGSLLDTALRSADTQARPVYRNRFE
AIRNKIPYRPLLVDAQGERLYPKPQAHGQQSAVVVGAQGQAVHTDRDNRIRVQFHWQRGERSHSGLSSPT
PDDHVGAPANEQAGTWVRVLAGLAPTAGANWGGQAVPRVGQEVLIDFIEGDIDRPVVIGTLYNGRGVDNA
QGNQAGQGAGSATGNAPAWFPGSSGAHNHAAVLSGIKTQALSASQSGGGGYNQLVFDDSPGQARAALQQH
ADAHDGASELNLGLLRQQTDNQRLATTGQGFELKTLYSAALRAGQGLLVSTEKSISAQLDMTQGLSQLSE
SAQKQQQLAETAQKHNARLEGESDAAKLPAVEAMGESIEVLKATQSASTGSSGSDGQGSSATTATTAFSA
PQLQLSSPAGIAAVTPASAIIAAGVTSSVTAGKDINQIAQGNLHYLSKSGISLFTYGKASNGSKPNQETG
MALHAAAGKVSVQSQAGQTLLTSAKQLTVASVGKDVSVAGKQHVQLAAQGAWLRLEGGNIEVHGPGAMEF
RASAKELTGPASSGSSASVPAPGPLADCEYKSGA
 
Nucleotide Sequence: 2835 bp     [Download]
>gi|300309346|ref|NC_014323.1|:818820-821654 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGAACCTGTCGGACCTGCCCGCCCTGTTCGGCGCGTGGAGCCAGTCGGCCCGCGTGATGCGCCTGCATA
CCCCGCTGGACCAGGACTACGGCCCCCATGCCCTGATGGCCGAGCGCCTGCAGGCGGTGGAGCAGGTCGG
CCCGGGTGAGGACAGCAGCGCCATCGATCAAGCCATCGCCGGCTATCGTCTGCAGCTGTCGTGCCTGAGC
CTGAACGCCGACATCTCGCTGCGCAAGCTGCTGGGCCAGCCCGTGCTGCTGGAACTGGATACCGATGGCG
GCGCGCGCGCCTTCCACGGCCATGTGACCGCCTGCCGCATGGAAGGCGCCAATGGCGGCATGGCCCGCTA
CCTGTTGACCATCGAACCCTGGCTGTCCTTCCTGCGGCACCGCCGCGACAGCGCCGTGTTCCAGGACATG
AGCGCACCCGCCATCATCGAAGCCGTCTTCGCCGACTATCGCGGCCAGGGCCGTCTGCAACCCGCCTGGC
GACTGGATCTGCAGGATGCCTCGGCCTATGCCAAGCGCAGCCTGGCCACGCAGTACCAGGAAACCGACCT
GGCCTTCGTCACCCGCCTCATGGTCGAGGAAGGGCTGTTCTACTATATCGAGCACCAGGGCGACAGCAAC
AGCGCCAGCCTGGGCAGCCATACGGTGGTGATCGCCGACCATAACGGTAGCTTCAAGCCCAATGCGCGCT
CCACCGTCGCCTTTGCGCAAACCAACGCCGTGATGGCCCAGGACAACATCGACCGCTGGCGCAGCGTACG
CCGCTGGCAGACCAATGCGGTCGAGATCCTCACCTGGGATTACCGCCAGACCGCCGTGCGCGCGGCCAGC
ACCGCCAGCAGCGGCGAGAACGCCCATGACAAGCTGGTCCTCACCAGCCGCGACGCCCCCGGCCAATACA
TCAACGAGAGCCCCGAACAGGCGCAGCGCCAGGCGCTCAACCAGATGCAGGCCATCGAAGTGCGCAACAA
GGTCTTCACCGGCGCGGGCACCGTGCGCAGCTTCCTGCCCGGCACCACCTTCACGCTCACCGGCCACTAC
GACCACGACGGCGGCGACGACGACCAGTTCGTCCTGCTGCGCGTGGTCCACCAGGCGCACAACAACCTGA
GCGCCGACCTCAAGGCCGGCGTGACGGCGCTGCTGGGCCAAGCCCAGCTGGACGATCACGACCACAAAGG
CAGCCTGCTCGACACCGCCTTGCGCTCCGCCGATACGCAGGCGCGCCCGGTCTACCGCAACCGCTTCGAA
GCCATCCGCAACAAGATTCCCTATCGCCCCCTGCTGGTCGATGCCCAGGGCGAACGCCTTTATCCCAAGC
CCCAGGCCCATGGCCAGCAGAGCGCCGTGGTCGTAGGCGCGCAGGGCCAGGCCGTGCACACTGACCGCGA
CAACCGCATCCGCGTGCAATTCCACTGGCAGCGCGGCGAGCGCAGCCACAGCGGCCTGTCCTCACCGACG
CCTGACGATCATGTGGGCGCCCCCGCCAACGAACAGGCCGGCACCTGGGTGCGCGTGCTGGCGGGCCTCG
CGCCCACGGCCGGCGCCAACTGGGGCGGCCAGGCCGTGCCTCGCGTGGGCCAGGAAGTGCTGATCGATTT
CATCGAAGGTGATATCGACCGACCGGTGGTGATCGGCACCCTCTACAACGGCCGCGGCGTCGACAATGCC
CAGGGCAACCAGGCCGGGCAGGGCGCAGGCAGCGCCACCGGCAATGCCCCGGCCTGGTTCCCGGGCAGCA
GTGGCGCGCACAATCATGCCGCCGTGCTCTCCGGCATCAAGACCCAGGCCCTCTCCGCCAGCCAGAGCGG
CGGCGGAGGCTATAACCAACTGGTATTCGACGACAGCCCCGGACAGGCGCGCGCAGCGCTGCAACAGCAC
GCCGACGCCCACGACGGCGCCAGCGAGCTCAACCTCGGCCTGCTGCGCCAGCAGACCGACAACCAGCGCC
TGGCCACGACCGGCCAGGGCTTCGAACTGAAGACCCTGTACAGCGCCGCGCTGCGCGCGGGGCAAGGCCT
GCTGGTCTCGACCGAAAAGAGCATCAGCGCCCAGCTCGACATGACGCAGGGACTGTCGCAATTGAGCGAG
AGCGCACAAAAGCAGCAGCAGCTGGCCGAGACCGCGCAAAAGCACAACGCCCGCCTGGAAGGCGAGAGCG
ACGCCGCCAAACTACCCGCGGTCGAAGCCATGGGGGAGAGCATTGAGGTGCTCAAGGCCACCCAGAGCGC
CAGCACCGGCAGCAGTGGCAGTGATGGCCAGGGCAGCAGCGCCACCACCGCCACAACCGCCTTCAGCGCC
CCGCAGCTGCAGCTCTCCAGCCCGGCCGGCATCGCCGCCGTCACCCCGGCCAGCGCCATCATCGCCGCGG
GTGTGACCAGCAGCGTCACCGCGGGCAAGGATATCAACCAGATCGCCCAAGGCAATCTGCATTACCTGAG
CAAATCCGGCATCAGCCTCTTCACCTATGGCAAGGCCAGCAACGGCAGCAAGCCGAACCAGGAAACCGGC
ATGGCCCTGCATGCAGCGGCGGGCAAGGTCAGCGTGCAGAGCCAGGCCGGGCAGACCTTGCTGACCTCGG
CCAAGCAGTTGACGGTGGCCAGCGTGGGCAAGGATGTCAGCGTTGCGGGCAAACAGCATGTGCAACTGGC
GGCGCAAGGCGCGTGGCTGCGGCTGGAAGGCGGCAATATCGAGGTGCATGGGCCGGGGGCGATGGAGTTC
AGGGCGAGTGCCAAGGAATTGACTGGGCCGGCCAGTTCTGGCTCCAGTGCCAGCGTGCCGGCGCCTGGGC
CGTTGGCTGATTGTGAGTACAAGAGTGGCGCCTGA

Protein ID: 300310098
SecReT6 ID405
T6SS typei4b
Gene symbol-
Locus tagHsero_0763
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]841882..844830 [+]
ProductVGR-related protein
NoteTssI
UniProt IDD8IZG2
KEGG IDhse:Hsero_0763
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.50E-62, Aligned region: 50..367
DUF2345 [PF10106], Evalue: 1.70E-35, Aligned region: 177..230
DUF2345 [PF10106], Evalue: 1.70E-35, Aligned region: 791..951
T6SS_Vgr [PF13296], Evalue: 8.40E-30, Aligned region: 297..329
T6SS_Vgr [PF13296], Evalue: 8.40E-30, Aligned region: 624..734
T6SS_Vgr [PF13296], Evalue: 8.40E-30, Aligned region: 858..873
Phage_base_V [PF04717], Evalue: 6.70E-22, Aligned region: 463..561
Protein Sequence: 982 a.a.     [Download]
>gi|300310098|ref|YP_003774190.1| VGR-related protein [Herbaspirillum seropedicae SmR1]
MSDLLTQLMQFTGASRLYSLSLGDAAPAGELLVEAFAASEGLHAVGLREVIVLSLDAGLRLKSLIGQRAT
LVTTLSDGSRTQFSGLVNEAAKLGSEGGLARYRLRIVPWVWLLSQSHNSRVWQDKTVIDIVEDVFADYAP
HAAWTWTDEVAPFMQQVQPRSYTIQYRESNLAFVSRLLAAEGLSWRVEESADAASGHRLVLFADSTSPRA
FPEDLTSTSPLGGSGIRFHAGTAREEQDSIQALAARRALQPASFTLLSYDYKSKQAVATSLPTRHEFGGK
DAPRLESYDSPGLYAYTDAAEADHYARLHLEASEARNKLWQARSTVRTLRPGTRFTLADGPLGLSAAQDG
APRQYAVLSVMSVGVNNLPKDAAEGLAELFGPIPPLLEDCVAACEEGQSLLHGQSGPDSLQLLGQTDIAG
VIAQARQLGYANAFEAIRADVIWRPVLADGTGLRLHARATARGSQSAIVVGPQGETSASSAGEIHCDRLG
RVRIRFHWQGRNNDAAATCWVRVAQRAASGGAGMQFLPRIGQEVLVQFIEDDIDRPVIVGALYNGRGEGA
AAPTPGGDTAQAGSDDPARAFTSATDLQASGQGNLAGGNAPTWHGGSQDSDGHGNTAAQWGIRSKEFGGS
GYNQIVFDDTDAQGRIQLKTTQSGSELNLGHLIHTADNYRGSFRGTGAELRTDAYGALRAGGGILFSSYK
IEQNAASRDPAGDNVGGMALLKQAALLGKTFNEATLTHKTVGLASHLGPTQASASTINDSAAPLEAIRVA
ASGMVDGSPENSGADVAAANTQTGESKLPHSTAALIGIAAKEGLGAVAGQHMQLANGETVNLLSGADSQQ
VAGNQYRLRSGQALGVLAGAMAAGEGGTGLQMIAAQKNIDVQAQADGLTVQARDQVRVISANAGVDWAAA
KKITLSTAGGANITIEGGNITVQCPGKLTIHAAQKLFAGPVSKTLPLPQMPNSVCKDCILNAMKQGAPGV
LV
 
Nucleotide Sequence: 2949 bp     [Download]
>gi|300309346|ref|NC_014323.1|:841882-844830 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGTCTGACCTGCTGACGCAACTGATGCAATTCACCGGTGCGAGTCGCCTTTACAGCCTCTCGCTGGGCG
ACGCCGCGCCCGCTGGCGAATTGCTGGTGGAGGCATTTGCCGCCTCGGAAGGGCTGCATGCGGTCGGGCT
GCGCGAAGTCATCGTCCTGAGCCTGGACGCCGGGCTGCGCCTGAAGTCCTTGATCGGGCAGCGCGCCACC
CTGGTGACGACCTTGTCCGATGGCAGCCGCACCCAGTTCTCGGGGCTGGTCAACGAGGCCGCCAAGCTCG
GCAGTGAGGGCGGCCTGGCCCGTTATCGCTTGCGCATCGTGCCCTGGGTCTGGCTGCTCTCGCAGTCGCA
TAACAGCCGGGTGTGGCAGGACAAGACCGTCATCGACATCGTCGAAGATGTCTTTGCCGACTATGCGCCC
CACGCCGCCTGGACCTGGACGGATGAGGTGGCGCCCTTCATGCAGCAGGTGCAGCCGCGCAGCTATACGA
TCCAGTACCGCGAAAGCAATCTGGCCTTCGTCAGCCGCCTGCTGGCCGCCGAGGGCCTGTCATGGCGCGT
GGAGGAATCTGCCGACGCAGCATCCGGCCATCGGCTGGTGCTGTTCGCCGATTCGACTTCGCCGCGCGCC
TTCCCCGAAGACCTCACCAGCACCAGTCCGCTCGGCGGCAGCGGCATCCGCTTCCACGCCGGTACCGCCC
GCGAGGAGCAGGACAGCATCCAGGCGCTGGCCGCGCGCCGGGCCTTGCAGCCGGCCTCGTTCACCTTGCT
GTCCTACGATTACAAGAGCAAGCAGGCGGTGGCCACCAGCCTGCCCACCCGTCACGAATTCGGCGGCAAG
GACGCCCCCCGCCTGGAAAGCTATGACAGTCCAGGCCTGTATGCCTATACCGATGCGGCCGAGGCCGATC
ACTATGCCCGCCTGCACCTGGAGGCCAGTGAAGCCCGCAACAAGCTCTGGCAGGCGCGCAGCACCGTGCG
CACCTTGCGTCCCGGCACGCGCTTTACGCTGGCCGACGGTCCGCTGGGCCTGTCCGCTGCGCAGGATGGC
GCGCCCCGGCAATACGCCGTGCTGTCGGTGATGAGCGTGGGTGTCAACAATCTGCCCAAGGATGCGGCCG
AAGGCCTGGCCGAACTGTTCGGCCCGATTCCACCCTTGCTGGAAGACTGCGTGGCCGCCTGCGAAGAAGG
CCAGTCGCTGCTGCACGGCCAGTCCGGCCCGGACTCTCTGCAACTGCTGGGGCAGACCGACATTGCCGGG
GTGATCGCGCAAGCCCGCCAGCTGGGGTATGCCAATGCCTTCGAGGCGATTCGCGCCGACGTGATCTGGC
GCCCGGTGCTGGCCGATGGCACCGGCTTGCGCCTGCACGCGCGTGCCACCGCGCGCGGCAGCCAGAGCGC
CATCGTGGTGGGGCCGCAGGGCGAGACCAGCGCCAGCAGCGCCGGCGAGATCCATTGCGACCGCCTGGGG
CGTGTGCGCATCCGCTTCCACTGGCAGGGCCGCAACAATGACGCCGCTGCCACCTGCTGGGTGCGCGTGG
CGCAACGCGCAGCCAGCGGTGGCGCGGGCATGCAGTTCCTTCCTCGCATCGGCCAGGAGGTGCTGGTGCA
ATTCATCGAGGACGATATCGATCGGCCCGTCATCGTCGGCGCGCTCTACAACGGCCGTGGCGAGGGCGCC
GCTGCGCCCACGCCCGGCGGCGATACTGCGCAGGCCGGCAGCGACGATCCTGCCCGCGCCTTCACCAGCG
CCACCGACCTGCAGGCCAGCGGCCAGGGCAACCTGGCCGGCGGCAATGCACCGACCTGGCACGGCGGCAG
CCAGGACAGCGATGGCCACGGCAACACTGCCGCGCAATGGGGTATCCGCTCCAAGGAATTCGGCGGTTCG
GGCTACAACCAGATCGTCTTCGACGATACCGATGCGCAAGGGCGCATCCAGCTCAAGACCACCCAGTCGG
GCAGCGAGCTCAACCTCGGTCACCTGATCCACACCGCAGACAACTATCGCGGGAGCTTCCGTGGCACCGG
CGCAGAGTTGCGTACCGATGCCTATGGCGCGCTGCGCGCTGGCGGCGGCATCCTGTTCTCCAGCTACAAG
ATCGAGCAGAACGCCGCCTCCCGTGACCCGGCCGGCGACAATGTCGGCGGCATGGCCTTGCTCAAGCAGG
CCGCCTTGCTGGGCAAGACCTTCAACGAGGCCACGCTCACCCACAAGACGGTCGGCCTGGCCAGCCATCT
GGGACCGACCCAGGCCAGCGCCAGCACCATCAACGACAGTGCCGCGCCGTTGGAAGCCATTCGCGTGGCG
GCCTCCGGGATGGTCGATGGTTCGCCCGAGAACAGTGGCGCAGACGTGGCAGCGGCCAATACGCAAACCG
GCGAGAGCAAGCTCCCGCACAGCACCGCGGCGCTGATCGGCATCGCGGCCAAGGAGGGATTGGGCGCCGT
GGCCGGGCAGCACATGCAGCTGGCCAATGGCGAGACGGTCAATCTCCTCTCCGGCGCCGACAGCCAGCAG
GTCGCCGGCAACCAGTATCGCTTGCGCAGCGGCCAGGCGCTGGGCGTGCTGGCCGGGGCGATGGCGGCAG
GCGAGGGCGGCACTGGCTTGCAGATGATCGCCGCGCAGAAGAACATCGACGTACAGGCCCAGGCGGACGG
ACTCACCGTCCAGGCACGCGACCAGGTCCGCGTGATCAGCGCCAATGCCGGCGTAGACTGGGCCGCCGCC
AAGAAGATCACGCTCTCCACCGCCGGCGGGGCCAACATCACCATCGAGGGTGGCAACATCACCGTGCAGT
GTCCGGGCAAGCTGACCATTCATGCCGCCCAGAAGCTGTTCGCCGGCCCCGTGTCCAAGACGCTGCCCTT
GCCCCAGATGCCCAATAGCGTCTGCAAGGACTGCATCCTCAATGCCATGAAGCAGGGTGCGCCGGGAGTG
CTGGTATGA