SecReT6
Protein ID: 300310072
SecReT6 ID405
T6SS typei4b
Gene symbol-
Locus tagHsero_0737
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]805963..806754 [-]
Producthypothetical protein
NoteTssL
UniProt IDD8IZD6
KEGG IDhse:Hsero_0737
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-53, Aligned region: 32..234
Protein Sequence: 263 a.a.     [Download]
>gi|300310072|ref|YP_003774164.1| hypothetical protein Hsero_0737 [Herbaspirillum seropedicae SmR1]
MNMTSAPSLLDQDSFPSSSPSPTSASAPVKANSLLDLMYDGFYALFMLRNGNAPLDEASFAIKMQKFLGD
VERNAKKLDVSPEDVYAAKYAFCASVDEIILRSNFTIRDAWERRPLQLTMFGDQLAGENFFKQLEDLRVR
GNAHVQALEVFHMCLLLGFQGKYALEGPEKLGYLTARLGDEIAHMKGKSAGFAPHWARPDAIVNKLRNDV
PLWAVGSLFALIALFAYLGLNWMLTSGTENGLAGYTDIVKLAPRTANLTITLP
 
Nucleotide Sequence: 792 bp     [Download]
>gi|300309346|ref|NC_014323.1|:c806754-805963 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGAACATGACCTCGGCCCCCTCCCTGCTCGACCAGGACAGCTTCCCGTCCTCCTCTCCATCGCCGACCT
CGGCCAGCGCGCCGGTAAAGGCCAATTCGCTGCTGGACCTGATGTATGACGGCTTCTATGCCTTGTTCAT
GCTCAGGAATGGCAACGCACCGCTGGATGAGGCCTCCTTCGCCATCAAGATGCAGAAATTCCTGGGTGAC
GTGGAGCGCAACGCCAAGAAGCTGGATGTCTCGCCGGAAGACGTCTACGCCGCCAAGTATGCGTTCTGCG
CCTCGGTGGATGAAATCATCCTGCGCTCCAACTTCACCATCCGCGATGCCTGGGAACGGCGTCCGCTGCA
GCTGACCATGTTCGGCGACCAACTGGCCGGCGAGAATTTCTTCAAGCAGCTGGAAGACCTGCGGGTGCGC
GGCAACGCCCACGTGCAGGCGCTGGAAGTGTTCCACATGTGCCTGCTGCTGGGTTTCCAGGGCAAGTACG
CGCTGGAGGGGCCGGAAAAGCTCGGCTACCTCACCGCCCGCCTGGGCGATGAAATCGCCCACATGAAAGG
CAAGAGCGCCGGTTTCGCACCGCATTGGGCGCGGCCCGACGCCATCGTCAACAAGCTGCGCAACGATGTG
CCGCTGTGGGCGGTGGGCTCGCTGTTCGCGCTCATCGCGCTGTTTGCCTACCTGGGCTTGAACTGGATGC
TCACCAGCGGCACCGAGAACGGCCTGGCCGGCTATACCGACATCGTCAAGCTGGCCCCGCGCACCGCCAA
CCTGACCATCACCCTGCCCTGA