SecReT6
Protein ID: 300310073
SecReT6 ID405
T6SS typei4b
Gene symbol-
Locus tagHsero_0738
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]806751..808097 [-]
Producthypothetical protein
NoteTssK
UniProt IDD8IZD7
KEGG IDhse:Hsero_0738
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.10E-128, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|300310073|ref|YP_003774165.1| hypothetical protein Hsero_0738 [Herbaspirillum seropedicae SmR1]
MNHSNKVLWGEGLFLRPQHFQRQDLYHETRLRQTASALHPYCWGVSALQVDRDALNNNTLRILELSLIFQ
DGEIYKAPDGDDLPDPIELGEIALTQQSVTFYAALPAMKSFGSNFAQAAGGNQSNRYLLDNSETPDLFTE
AAKAEMSYLKKAVRLVSENEPRDSLVCIPIVRLRRSNSSGFEMDPNFVPPSLSVHAAPLLLLRLRRLMDA
LQAKVSALYGHHREPSKSVVEFRSGDITSFWLLHTASTAYASLSHYLHNPLLHPERLYEQLLTLGGSLMT
FSRSVALADLPAYDHQDPGPAFARLDGIIRELLDTVISSRYFAIALNETKPSYHLGMLDSGKIDEKTNFY
LAVNADLPAIELVDVVPLRFKIGAPDDVEKFVLAALPGVKLVHSPQVPAALPVRPDTYYFALENKGAMYE
RMLQAQSICIYVPAGIRDLKLELLAVTQ
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|300309346|ref|NC_014323.1|:c808097-806751 Herbaspirillum seropedicae SmR1 chromosome, complete genome
GTGAATCATTCCAATAAAGTCCTGTGGGGAGAAGGCCTGTTCCTGCGGCCGCAGCACTTCCAGCGCCAAG
ACCTCTATCACGAGACCCGGCTGCGCCAGACCGCCTCGGCCCTGCATCCCTATTGCTGGGGCGTCTCGGC
CCTGCAGGTGGACCGCGATGCACTGAACAACAATACCCTGCGCATCCTGGAGCTGTCGCTGATCTTCCAG
GATGGCGAGATCTACAAGGCGCCCGATGGCGACGACCTGCCCGATCCCATCGAGCTGGGTGAGATCGCCC
TGACGCAGCAGTCGGTCACCTTCTATGCGGCGCTGCCGGCAATGAAGAGCTTCGGCAGCAACTTCGCCCA
GGCCGCTGGCGGCAACCAGTCCAATCGTTATCTGCTGGACAATAGCGAGACCCCCGATCTGTTCACCGAG
GCCGCCAAGGCTGAGATGAGCTACCTGAAGAAGGCGGTGCGCCTGGTCTCGGAAAACGAACCGCGCGACT
CGCTGGTCTGCATCCCCATCGTGCGCCTGCGTCGTTCCAATTCCTCGGGCTTCGAGATGGATCCCAATTT
CGTGCCGCCCAGCCTGTCGGTGCACGCCGCGCCGCTCTTGCTGCTGCGCCTGCGCCGCCTGATGGATGCG
CTGCAGGCCAAGGTCAGCGCGCTCTACGGCCATCACCGCGAGCCCAGCAAGAGCGTGGTGGAATTCCGCT
CCGGCGACATCACCTCGTTCTGGCTGCTGCACACCGCCAGCACGGCCTATGCCAGCCTGTCGCATTACCT
CCACAATCCCTTGCTGCACCCGGAACGTCTCTACGAACAGTTGCTGACCCTGGGCGGCTCGCTGATGACC
TTCTCGCGCAGCGTCGCGCTGGCCGACCTGCCGGCCTATGATCACCAGGATCCAGGTCCGGCCTTCGCGC
GCCTGGATGGCATCATCCGCGAATTGCTCGACACCGTGATTTCCTCGCGCTACTTCGCCATCGCCCTCAA
CGAGACCAAGCCGTCATATCACCTGGGCATGCTGGACTCGGGCAAGATCGACGAGAAGACCAATTTCTAC
CTGGCCGTCAACGCCGACCTGCCGGCCATCGAACTGGTCGATGTGGTGCCGCTGCGCTTCAAGATCGGCG
CGCCGGACGATGTCGAGAAGTTCGTGCTGGCCGCGCTGCCGGGCGTGAAGCTGGTGCACTCGCCGCAAGT
GCCTGCGGCGCTGCCGGTGCGGCCGGATACCTACTACTTCGCGCTGGAGAACAAGGGCGCCATGTACGAG
CGCATGTTGCAGGCGCAATCGATCTGCATCTATGTCCCGGCGGGTATCCGGGATCTGAAACTTGAACTGT
TGGCGGTGACCCAATGA