SecReT6
Protein ID: 300310074
SecReT6 ID405
T6SS typei4b
Gene symbol-
Locus tagHsero_0739
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]808195..808719 [-]
Producthypothetical protein
NoteTssJ
UniProt IDD8IZD8
KEGG IDhse:Hsero_0739
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.00E-32, Aligned region: 12..144
Protein Sequence: 174 a.a.     [Download]
>gi|300310074|ref|YP_003774166.1| hypothetical protein Hsero_0739 [Herbaspirillum seropedicae SmR1]
MEALGLKKPDAPEVPDSMKQPRSVFIKLHASKALNLDAQKRPLALVVKIYKLKQNISFQQASYETFLSPQ
KEKELLGADLLEVKEVTLVPGQRYEAVEKVSYEAGYVGVVALYVNPAQQRWRLAFKADESEKSGITVGLQ
SCSVTVGAGAAAIDAQGQPLEKNLMLAPVQCPSS
 
Nucleotide Sequence: 525 bp     [Download]
>gi|300309346|ref|NC_014323.1|:c808719-808195 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGGAGGCGCTGGGCCTGAAGAAGCCCGATGCACCTGAAGTCCCGGATTCGATGAAGCAGCCCCGCTCGG
TCTTCATCAAGCTGCACGCTTCCAAGGCGCTCAACCTGGATGCGCAGAAGCGGCCGCTGGCCCTGGTCGT
AAAAATTTATAAGCTCAAGCAGAACATTAGTTTCCAGCAGGCGTCATATGAGACGTTTCTAAGTCCGCAA
AAGGAAAAGGAGCTGCTCGGGGCTGATCTTCTGGAGGTCAAGGAAGTTACACTGGTGCCCGGCCAGCGTT
ACGAAGCGGTCGAGAAAGTCAGTTACGAAGCCGGTTACGTTGGCGTGGTGGCGCTGTACGTCAATCCCGC
CCAGCAACGCTGGCGCCTGGCTTTCAAGGCGGACGAGAGCGAAAAGAGCGGCATCACCGTCGGCTTGCAG
TCCTGTTCCGTCACCGTCGGGGCGGGCGCCGCCGCCATCGACGCCCAGGGCCAGCCGCTGGAGAAGAACC
TGATGCTGGCGCCGGTGCAGTGCCCGTCAAGCTGA