SecReT6
Protein ID: 300310076
SecReT6 ID405
T6SS typei4b
Gene symbol-
Locus tagHsero_0741
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]809942..810442 [+]
Producthypothetical protein
NoteTssB
UniProt IDD8IZE0
KEGG IDhse:Hsero_0741
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.50E-57, Aligned region: 11..165
Protein Sequence: 166 a.a.     [Download]
>gi|300310076|ref|YP_003774168.1| hypothetical protein Hsero_0741 [Herbaspirillum seropedicae SmR1]
MAKRESIQKKLQKVRPPRVQMTYDVEIGDAIEKKELAFVTGVVGDFGGNSEVPQPRLKDRKFVNVDPDNF
DEVMKAIEPRAVYRVPNELSDKGGEFAVELKFRSMEDFRPEAVVQQVEPLRKLLEARTKLADLRNKIAGN
DKLEDILNDVLNSTEKLAELRQQTNK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|300309346|ref|NC_014323.1|:809942-810442 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGGCAAAAAGAGAAAGCATCCAGAAGAAACTCCAGAAGGTCCGTCCCCCGCGTGTGCAGATGACCTATG
ACGTCGAGATCGGCGACGCGATCGAGAAGAAGGAACTGGCCTTCGTCACCGGCGTGGTCGGTGATTTCGG
CGGCAATTCGGAAGTGCCGCAGCCGCGCCTGAAGGACCGCAAGTTCGTCAATGTCGATCCCGACAATTTC
GATGAGGTCATGAAGGCCATCGAACCACGCGCCGTCTATCGCGTGCCCAACGAACTTTCCGACAAGGGCG
GCGAATTCGCGGTGGAACTGAAGTTCCGCTCGATGGAGGATTTCCGTCCCGAGGCGGTGGTGCAACAGGT
CGAACCGCTGCGCAAGCTGCTCGAAGCCCGCACCAAGCTGGCCGACCTGCGTAACAAGATCGCCGGCAAC
GACAAGCTGGAAGACATCCTCAACGATGTGCTCAACAGTACCGAAAAGCTCGCCGAGCTGCGTCAGCAAA
CCAACAAGTAA