SecReT6
Protein ID: 300310077
SecReT6 ID405
T6SS typei4b
Gene symbol-
Locus tagHsero_0742
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]810454..811941 [+]
Producthypothetical protein
NoteTssC
UniProt IDD8IZE1
KEGG IDhse:Hsero_0742
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.40E-190, Aligned region: 67..490
Protein Sequence: 495 a.a.     [Download]
>gi|300310077|ref|YP_003774169.1| hypothetical protein Hsero_0742 [Herbaspirillum seropedicae SmR1]
MSAQLHSETAAAPAAASASLLDDIVEQSKVAKSASEHDRAKDLITELVNQVMEGTVVVSSNLSATLDARI
AELDKLISSQVSAIMHAPEFQKLEGSWTGLNYLVRNTTVGENQKIKILNATKKELVKDFNSALEFDQSAM
FKKVYEEEFGTFGGAPFGVLLGDFEITRQPEDMYFIEQMSRIAAASHAPFVTAASPELFGLESYADLGKP
RDLSKVFDTVEYAKWKSFRESEDSRYVGLTLPRFLGRLPFNPKDGTTVEGFNFVEDVDGSDHSKYLWCNA
AYAFGTKLTKAFEDFGWCAAIRGVEGGGLVEDLPTHTFKTDEGEVALKCPTEIAITDRREKELSDLGFIS
LVHCKNTDYAAFFGAQSAQKPKKYNTDSANANAVLSSQLQYIFAVSRIAHYMKSMMRDKIGSFAAASNVE
DFLNRWISQYVLLDDNATQEAKAQFPLREASVQVSEVPGRPGVYRAVSFLRPHFQLDELSVSLRLVAELP
QAGKS
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|300309346|ref|NC_014323.1|:810454-811941 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGTCCGCTCAACTCCATTCCGAAACGGCAGCTGCCCCCGCAGCGGCCAGCGCCAGCCTGCTGGACGATA
TCGTCGAACAGAGCAAGGTCGCCAAGTCCGCCTCTGAACATGACCGTGCCAAGGACCTCATCACCGAACT
GGTGAACCAGGTCATGGAGGGGACGGTGGTGGTCTCCAGCAATCTCTCGGCGACGCTGGATGCCCGTATT
GCAGAGCTGGACAAGTTGATCTCCAGCCAGGTCAGCGCCATCATGCACGCGCCGGAATTCCAGAAGCTGG
AAGGCAGCTGGACCGGCCTGAACTACCTGGTGCGCAACACCACGGTGGGCGAGAACCAGAAGATCAAGAT
CCTCAACGCCACCAAGAAGGAACTGGTCAAGGACTTCAACTCCGCACTGGAATTCGACCAGAGCGCCATG
TTCAAGAAGGTCTACGAAGAAGAATTCGGCACCTTCGGTGGCGCTCCCTTCGGCGTGCTGCTGGGCGATT
TCGAGATCACCCGCCAGCCCGAGGACATGTATTTCATCGAGCAGATGTCGCGCATTGCCGCGGCCTCGCA
CGCGCCCTTCGTCACGGCCGCCTCGCCCGAACTGTTCGGCCTGGAGTCCTATGCCGACCTGGGCAAGCCG
CGCGACCTCTCCAAGGTCTTCGATACGGTGGAATACGCCAAGTGGAAGTCCTTCCGGGAATCCGAGGATT
CCCGCTATGTCGGCCTGACCCTGCCGCGCTTCCTGGGCCGCCTGCCGTTCAACCCCAAGGATGGCACCAC
GGTCGAAGGCTTCAATTTCGTCGAGGACGTCGACGGCAGCGACCATTCCAAATACCTCTGGTGCAACGCC
GCCTACGCCTTCGGCACCAAGCTGACCAAGGCCTTCGAGGACTTCGGCTGGTGCGCGGCGATTCGCGGTG
TGGAAGGCGGCGGCCTGGTGGAAGACCTGCCGACCCACACCTTCAAGACCGACGAGGGCGAAGTGGCGCT
GAAGTGCCCCACCGAAATCGCCATCACCGACCGCCGTGAAAAGGAGCTCTCCGACCTGGGCTTCATCTCG
CTGGTGCATTGCAAGAACACCGACTACGCCGCCTTCTTCGGCGCGCAGTCCGCGCAGAAGCCGAAGAAGT
ACAACACCGATTCGGCCAACGCCAATGCAGTCCTGTCGTCCCAGCTGCAATACATCTTCGCCGTCTCGCG
CATCGCCCACTACATGAAATCGATGATGCGCGACAAGATCGGCAGCTTTGCCGCTGCCTCCAACGTGGAA
GATTTCCTCAATCGCTGGATCTCCCAATACGTGCTGCTGGATGACAATGCCACGCAGGAAGCCAAGGCGC
AGTTCCCGTTGCGCGAGGCTTCGGTACAGGTGTCGGAAGTGCCGGGACGGCCGGGCGTCTATCGCGCCGT
GTCGTTCCTGCGTCCGCATTTTCAGCTGGATGAACTGTCTGTGTCGCTGCGCCTGGTGGCGGAGCTGCCG
CAGGCCGGCAAGTCCTGA