SecReT6
Protein ID: 300310078
SecReT6 ID405
T6SS typei4b
Gene symbol-
Locus tagHsero_0743
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]811974..812465 [+]
Producthypothetical protein
NoteTssD
UniProt IDD8IZE2
KEGG IDhse:Hsero_0743
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.00E-44, Aligned region: 6..139
Protein Sequence: 163 a.a.     [Download]
>gi|300310078|ref|YP_003774170.1| hypothetical protein Hsero_0743 [Herbaspirillum seropedicae SmR1]
MAIDVYLQIDGIKGESTDDLHKDWIECKTVDWEVLQPKSATASTGGGHTAERCEHKDIVFTKVADLASPL
LLQNSSSGKTIPKAKFEFMRADGKGERVRYFEIELTNVMISSVKPSIESGEILNETVGLKYSTVKWKYTQ
QKKDGGTAGNTSGGWDLSTNKVI
 
Nucleotide Sequence: 492 bp     [Download]
>gi|300309346|ref|NC_014323.1|:811974-812465 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGGCAATTGACGTCTACCTCCAAATCGACGGTATCAAGGGCGAATCGACCGATGATCTGCACAAGGACT
GGATCGAGTGCAAGACCGTCGACTGGGAAGTCCTGCAGCCCAAGTCGGCTACGGCCTCCACCGGTGGCGG
CCACACCGCCGAGCGCTGCGAGCACAAGGATATCGTCTTCACCAAGGTCGCCGACCTGGCTTCCCCGCTG
CTGCTGCAGAACTCGTCCTCGGGCAAGACCATCCCCAAGGCCAAGTTCGAATTCATGCGCGCCGACGGCA
AGGGCGAGCGCGTGCGCTACTTCGAGATCGAACTGACCAACGTGATGATCAGCAGCGTCAAGCCCAGCAT
CGAGTCCGGCGAGATCCTCAACGAAACCGTCGGCCTGAAGTACTCCACCGTCAAGTGGAAGTACACCCAG
CAGAAGAAGGATGGCGGCACCGCCGGCAACACCTCGGGCGGCTGGGACCTGTCGACCAACAAGGTCATCT
GA