SecReT6
Protein ID: 300310079
SecReT6 ID405
T6SS typei4b
Gene symbol-
Locus tagHsero_0744
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]812608..813096 [+]
Producthypothetical protein
NoteTssE
UniProt IDD8IZE3
KEGG IDhse:Hsero_0744
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.60E-20, Aligned region: 30..135
Protein Sequence: 162 a.a.     [Download]
>gi|300310079|ref|YP_003774171.1| hypothetical protein Hsero_0744 [Herbaspirillum seropedicae SmR1]
MKGFAPSLFDRLMHESDRVSPNTVVSRLSIEELKDAVARDLEAMLNTRAVIPEQLFRHFPECSKSIIAYG
LNDFAGMSLASLDDRAAICRSLEEAIARHEPRLRNVRASLEVQEGSINRLNFAISALLVVNAAREAVSFD
AVLQPSSLQYSISKGRATRIGV
 
Nucleotide Sequence: 489 bp     [Download]
>gi|300309346|ref|NC_014323.1|:812608-813096 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGAAAGGCTTTGCTCCCAGCCTCTTTGACAGGCTCATGCACGAGAGCGACCGGGTGTCGCCCAATACCG
TGGTCAGCCGCCTGTCGATCGAAGAACTCAAGGACGCCGTGGCCCGCGACCTCGAGGCCATGCTCAATAC
GCGCGCCGTGATCCCGGAACAGCTGTTCCGGCATTTTCCCGAATGCAGCAAATCCATCATTGCCTATGGT
CTGAACGACTTCGCCGGCATGAGCCTGGCCAGCCTCGATGACCGCGCCGCCATCTGCCGCTCGCTGGAAG
AGGCGATCGCCCGCCACGAGCCGCGCCTGCGCAATGTGCGCGCCTCCCTGGAGGTGCAGGAAGGCAGCAT
CAACCGTCTCAATTTCGCCATCAGCGCCTTGCTGGTCGTCAATGCGGCCCGCGAGGCGGTCAGCTTCGAC
GCCGTGCTGCAGCCTTCCAGCCTGCAGTATTCGATCAGCAAGGGGCGCGCCACGCGCATAGGAGTCTAA