SecReT6
Protein ID: 300310080
SecReT6 ID405
T6SS typei4b
Gene symbol-
Locus tagHsero_0745
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]813097..814941 [+]
Producthypothetical protein
NoteTssF
UniProt IDD8IZE4
KEGG IDhse:Hsero_0745
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.40E-202, Aligned region: 4..611
Protein Sequence: 614 a.a.     [Download]
>gi|300310080|ref|YP_003774172.1| hypothetical protein Hsero_0745 [Herbaspirillum seropedicae SmR1]
MQELLPYYERELSFLRRYSREFSERYPKIAGSLLMSGEVCEDPHIERMIQSYALLNARVSKRLDDDYPEF
TEALFEVLYPHYLRPFPSCSIARMDYAASAAQLTTASVIPRGTALTTRQVKGVACKFQTAYDVTVAPIRL
SHATFAPIIEAPEAVTLPTSVSSSLSIVIDTTSEQLTLAQLGLSSLRVFIDGEASFCAALRDSLFMRSVA
AWVELPNSGRWTALRKVPLAEVGFAEDDALIDFPARSHPAYRLLTEYFCFPEKFNFFDLDLAAILALLPT
GTRKFTLHLGLSGLRADSHVARQLGGVSAANLLLGCTPVINLFRQRGDPIRLTHAGASYPVVPDARRAFG
YEVYSIDSVQLVRQTPQGESVTQFRPFYSLRHGQSPEKEGHYWAMRRDELVALKSPGYETEISIVDIDFD
PAEVETDTLSIELTCTNRDLPASLTYGLPGGDLQMEGGGLVRSAALLRKPTLPARFERGRGAHWRLISHL
SLNHLSLMRGGLEAFQEMLTLYDLSNSPISQRQIGAIVSIDHKASTAWLPGNPFASLVRGIEVKLTVDEE
GFVGSGLHAFAGVIDRFLGLYVHANSFTQLRVLSKRTAEELLICKPRSGDLNLA
 
Nucleotide Sequence: 1845 bp     [Download]
>gi|300309346|ref|NC_014323.1|:813097-814941 Herbaspirillum seropedicae SmR1 chromosome, complete genome
GTGCAAGAGCTGCTTCCCTACTATGAACGCGAACTGAGCTTCCTGCGGCGCTACTCGCGGGAGTTTTCCG
AACGCTATCCCAAGATCGCCGGCAGCCTGCTGATGTCCGGCGAGGTCTGCGAAGACCCGCACATCGAGCG
CATGATCCAGTCCTATGCCCTGCTCAATGCGCGCGTCTCCAAGCGGCTCGACGACGATTACCCGGAATTC
ACCGAAGCCCTCTTCGAGGTGCTCTATCCGCACTACCTGCGGCCTTTCCCGTCCTGCTCGATTGCGCGCA
TGGATTACGCCGCCTCGGCCGCCCAGCTGACCACGGCCAGCGTGATCCCGCGCGGCACCGCGCTGACCAC
GCGCCAGGTCAAGGGCGTGGCGTGCAAGTTCCAGACCGCCTACGACGTCACCGTAGCGCCGATCCGCCTC
TCGCACGCCACCTTCGCCCCCATCATCGAAGCCCCCGAGGCAGTCACGCTGCCGACCTCGGTGAGCTCGT
CGCTGTCCATCGTCATCGACACCACCTCGGAACAGCTCACGCTGGCGCAGCTGGGTCTGTCTTCGCTGCG
CGTGTTCATCGATGGCGAGGCCTCGTTCTGCGCAGCCCTGCGTGACAGCCTGTTCATGCGCAGCGTAGCG
GCCTGGGTCGAACTGCCCAACAGTGGCCGCTGGACTGCCTTGCGCAAGGTGCCGCTGGCCGAGGTGGGTT
TTGCCGAAGACGATGCGCTGATCGATTTCCCTGCGCGCTCGCACCCGGCCTATCGCCTGTTGACCGAATA
TTTCTGCTTCCCCGAGAAATTCAATTTCTTTGACCTGGACCTGGCGGCCATCCTGGCCTTGCTGCCCACC
GGCACGCGCAAGTTCACGCTGCACCTGGGCTTGTCGGGCCTGCGCGCCGATTCTCACGTAGCCCGCCAAC
TGGGCGGCGTGAGCGCGGCCAATCTGCTGCTGGGCTGCACCCCCGTCATCAACCTGTTCCGCCAGCGCGG
CGACCCGATCCGCCTGACCCATGCCGGCGCCTCCTATCCGGTGGTGCCGGACGCTCGTCGCGCCTTCGGT
TATGAGGTCTATTCCATCGATTCGGTGCAACTGGTGCGGCAGACCCCGCAGGGCGAATCGGTGACCCAGT
TCCGTCCCTTCTACTCGTTGCGCCATGGCCAGTCGCCGGAAAAGGAAGGGCACTACTGGGCCATGCGCCG
CGACGAGCTGGTAGCCTTGAAGAGCCCCGGCTACGAGACCGAGATTTCCATCGTCGATATCGATTTCGAT
CCCGCCGAGGTAGAGACCGATACGCTGTCCATCGAACTGACCTGCACCAACCGCGACCTGCCAGCCTCGC
TCACCTATGGCCTGCCGGGCGGCGATCTGCAGATGGAAGGCGGCGGACTGGTGCGTTCGGCCGCGCTGCT
GCGCAAGCCCACGCTGCCGGCGCGCTTCGAGCGCGGGCGCGGTGCGCACTGGCGGCTGATCTCGCATCTG
TCGCTGAACCACCTCTCGCTCATGCGCGGCGGGCTGGAAGCCTTCCAGGAGATGCTCACCCTCTACGACC
TGTCCAATTCGCCGATCTCGCAGCGCCAGATCGGCGCCATCGTGTCCATCGACCACAAGGCCAGCACCGC
CTGGCTGCCTGGCAACCCCTTTGCCAGCCTGGTGCGGGGCATCGAGGTCAAGCTCACCGTCGATGAAGAG
GGCTTCGTCGGTAGCGGACTGCATGCCTTTGCCGGCGTGATCGACCGCTTCCTGGGTCTGTACGTGCACG
CCAACAGCTTTACGCAATTACGCGTGTTATCCAAACGCACCGCAGAGGAACTGCTGATATGCAAGCCACG
CAGCGGCGATTTGAACCTAGCGTGA