SecReT6
Protein ID: 300310081
SecReT6 ID405
T6SS typei4b
Gene symbol-
Locus tagHsero_0746
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]814905..815987 [+]
Producthypothetical protein
NoteTssG
UniProt IDD8IZE5
KEGG IDhse:Hsero_0746
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.20E-84, Aligned region: 18..341
Protein Sequence: 360 a.a.     [Download]
>gi|300310081|ref|YP_003774173.1| hypothetical protein Hsero_0746 [Herbaspirillum seropedicae SmR1]
MQATQRRFEPSVIERLFAAPHRFQFFQAVRMIELWFKRNGVAPERAVCDFLRFANRTALGFPASEIEAID
AVASSDDTSVAGMAQSLREGKMKYVRLTPTFMGFLGGSGALPAHYTERIARHQIEHRDEGPRAFLDVFST
RSLALFYQAWSKYRLAFQYEMGRRDKFLPLLLSLSGIGFRSLRERLLEVDGRGVRDESIAHFAAALSHRP
ASAPYMQQVLSEYFSIPLTIEQFVGQWYDVPREHQTMLGSTNSALGTAMAGQRVWQRDLRMRLRLGPLAL
PDFEQFLPGARASQALSRMLGVFTGPTLEYEIQLILRAEDVRGLGLSPDRTGGRLGWDSFVATAPQQQDR
ADICYQLAVH
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|300309346|ref|NC_014323.1|:814905-815987 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGCAAGCCACGCAGCGGCGATTTGAACCTAGCGTGATCGAGCGGCTCTTCGCCGCTCCCCATCGCTTCC
AGTTTTTCCAGGCCGTGCGCATGATCGAGCTCTGGTTCAAGCGCAATGGCGTGGCGCCCGAGCGCGCAGT
GTGCGACTTCCTGCGTTTCGCCAATCGCACCGCGCTGGGTTTTCCTGCCAGCGAGATCGAGGCCATCGAC
GCCGTCGCCAGCAGCGACGATACCTCGGTGGCCGGCATGGCGCAGTCGCTGCGCGAAGGCAAGATGAAGT
ACGTGCGCCTGACGCCCACCTTCATGGGTTTCCTGGGCGGCAGCGGCGCGCTGCCTGCGCACTATACCGA
GCGCATCGCCCGCCACCAGATCGAGCACCGCGACGAAGGTCCGCGGGCCTTCCTGGATGTGTTCTCGACG
CGCTCGCTGGCCTTGTTCTACCAGGCCTGGAGCAAGTACCGCCTGGCCTTCCAGTACGAGATGGGACGCC
GCGACAAATTCCTGCCGCTGCTGCTGTCGCTGTCGGGCATCGGTTTTCGCTCGCTGCGCGAACGCCTGCT
GGAAGTCGATGGCCGCGGCGTGCGCGATGAATCCATCGCCCATTTCGCCGCCGCACTGAGTCACCGGCCC
GCCTCTGCACCTTACATGCAGCAGGTATTGAGCGAGTATTTCTCGATACCGCTGACCATCGAGCAATTCG
TCGGCCAATGGTACGACGTACCGCGCGAGCACCAGACCATGCTGGGATCGACCAACTCGGCGCTGGGCAC
CGCCATGGCCGGCCAGCGCGTCTGGCAGCGCGACCTGCGCATGCGCCTGCGCCTAGGGCCGCTGGCCTTG
CCCGACTTCGAGCAGTTCCTGCCGGGCGCGCGCGCATCGCAGGCGCTCTCGCGCATGCTGGGCGTATTCA
CCGGCCCCACGCTGGAGTACGAGATCCAGCTGATCTTGCGCGCCGAAGATGTACGCGGACTGGGATTGTC
ACCGGACCGTACCGGCGGCCGCCTGGGCTGGGACAGCTTCGTGGCCACCGCACCGCAACAGCAGGACCGG
GCCGATATCTGCTATCAGCTCGCCGTGCACTGA