SecReT6
Protein ID: 300310082
SecReT6 ID405
T6SS typei4b
Gene symbolclpB
Locus tagHsero_0747
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]816027..818708 [+]
ProductClpA/B-type chaperone protein
NoteTssH
UniProt IDD8IZE6
KEGG IDhse:Hsero_0747
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-43, Aligned region: 238..282
AAA_2 [PF07724], Evalue: 1.40E-43, Aligned region: 622..792
AAA [PF00004], Evalue: 2.30E-19, Aligned region: 238..351
AAA [PF00004], Evalue: 2.30E-19, Aligned region: 523..550
AAA [PF00004], Evalue: 2.30E-19, Aligned region: 628..746
AAA_5 [PF07728], Evalue: 2.30E-14, Aligned region: 238..260
AAA_5 [PF07728], Evalue: 2.30E-14, Aligned region: 474..505
AAA_5 [PF07728], Evalue: 2.30E-14, Aligned region: 627..749
ClpB_D2-small [PF10431], Evalue: 5.60E-13, Aligned region: 798..871
AAA_16 [PF13191], Evalue: 4.40E-11, Aligned region: 109..177
AAA_16 [PF13191], Evalue: 4.40E-11, Aligned region: 215..261
AAA_16 [PF13191], Evalue: 4.40E-11, Aligned region: 282..316
AAA_16 [PF13191], Evalue: 4.40E-11, Aligned region: 462..547
AAA_16 [PF13191], Evalue: 4.40E-11, Aligned region: 622..668
AAA_16 [PF13191], Evalue: 4.40E-11, Aligned region: 694..716
AAA_16 [PF13191], Evalue: 4.40E-11, Aligned region: 793..826
Clp_N [PF02861], Evalue: 2.20E-10, Aligned region: 23..74
Clp_N [PF02861], Evalue: 2.20E-10, Aligned region: 113..125
AAA_22 [PF13401], Evalue: 3.40E-06, Aligned region: 237..319
AAA_22 [PF13401], Evalue: 3.40E-06, Aligned region: 624..648
AAA_22 [PF13401], Evalue: 3.40E-06, Aligned region: 689..721
Sigma54_activat [PF00158], Evalue: 3.60E-06, Aligned region: 233..291
Sigma54_activat [PF00158], Evalue: 3.60E-06, Aligned region: 627..751
AAA_29 [PF13555], Evalue: 3.50E-05, Aligned region: 227..254
AAA_29 [PF13555], Evalue: 3.50E-05, Aligned region: 623..652
AAA_17 [PF13207], Evalue: 4.40E-05, Aligned region: 238..285
AAA_17 [PF13207], Evalue: 4.40E-05, Aligned region: 627..663
AAA_23 [PF13476], Evalue: 7.20E-05, Aligned region: 238..254
AAA_23 [PF13476], Evalue: 7.20E-05, Aligned region: 477..522
AAA_23 [PF13476], Evalue: 7.20E-05, Aligned region: 624..655
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 232..261
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 627..645
NACHT [PF05729], Evalue: 0.00014, Aligned region: 238..266
NACHT [PF05729], Evalue: 0.00014, Aligned region: 628..647
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 236..260
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 625..649
AAA_25 [PF13481], Evalue: 0.00026, Aligned region: 238..261
AAA_25 [PF13481], Evalue: 0.00026, Aligned region: 451..487
AAA_25 [PF13481], Evalue: 0.00026, Aligned region: 623..649
FUSC [PF04632], Evalue: 0.0003, Aligned region: 445..551
Arch_ATPase [PF01637], Evalue: 0.0013, Aligned region: 289..389
Arch_ATPase [PF01637], Evalue: 0.0013, Aligned region: 496..549
Arch_ATPase [PF01637], Evalue: 0.0013, Aligned region: 626..668
Arch_ATPase [PF01637], Evalue: 0.0013, Aligned region: 698..721
RNA_helicase [PF00910], Evalue: 0.0037, Aligned region: 239..260
RNA_helicase [PF00910], Evalue: 0.0037, Aligned region: 628..649
Zeta_toxin [PF06414], Evalue: 0.0037, Aligned region: 238..259
Zeta_toxin [PF06414], Evalue: 0.0037, Aligned region: 494..538
Zeta_toxin [PF06414], Evalue: 0.0037, Aligned region: 621..667
SRP54 [PF00448], Evalue: 0.0046, Aligned region: 238..261
SRP54 [PF00448], Evalue: 0.0046, Aligned region: 626..658
DUF2075 [PF09848], Evalue: 0.0048, Aligned region: 238..340
DUF2075 [PF09848], Evalue: 0.0048, Aligned region: 627..648
T2SE [PF00437], Evalue: 0.0094, Aligned region: 219..261
T2SE [PF00437], Evalue: 0.0094, Aligned region: 617..664
T2SE [PF00437], Evalue: 0.0094, Aligned region: 809..837
MobB [PF03205], Evalue: 0.0094, Aligned region: 239..263
MobB [PF03205], Evalue: 0.0094, Aligned region: 626..666
AAA_18 [PF13238], Evalue: 0.0095, Aligned region: 238..258
AAA_18 [PF13238], Evalue: 0.0095, Aligned region: 629..648
Protein Sequence: 893 a.a.     [Download]
>gi|300310082|ref|YP_003774174.1| ClpA/B-type chaperone protein [Herbaspirillum seropedicae SmR1]
MGINLKSLISKLNDSSRLATERAASLCMARGQYEVDLEHLFLALLENPQTDFSLIVRRSGISPDSLQADL
EHEISQFKNGNTRTPVLSSHLQTLFEHGWLIASLDGERPSIRSGHLLLALLTQTELAQLAYRGSKLFARF
KVDELKHDLAKLTEGSVEAPALASASASAAADGQADEQQGGDPVGEMRAGGRTPALDQYTTNLTQRAREG
KIDPVVGRDGEIRQAVDILLRRRQNNPILTGEAGVGKTAVVEGLALRIAQDDVPQALQGVEIHTLDMGLL
QAGASVKGEFENRLKGVIDEVKKSPHPIILFIDEAHTMIGAGGQAGQNDAANLLKPALARGELRTIAATT
WSEYKKYFEKDAALARRFQVIKVEEPTEEVACAMLRAMAPLMEKHFGVRVYDEAITEAVRLSHRYISGRQ
LPDKAISVLDTACAKVALGQNATPARLEGVTRRLERLAAEIAALERETRSGASHATRLGELQAQHAQAIA
EQTELQQRWEQERELNGRIQAARAALEEANQESASSQDSAAARSELQQLLAQLKEHQGETPMVPVQVDGH
VVAEIVAGWTGIPLGKMVKDEIKTVLGLDALLKERVLGQPQATAAVAQRVRTSRANLDDPGKPKGVFLFV
GPSGVGKTETALALADVLYGGERKLITINMSEYQEAHTVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVV
LLDEVEKAHPDVLELFFQVFDKGVMDDGEGREIDFKNTIIILTSNVASSQLMQACLNKSAAELPTPDELD
VLIRPQLVKAFKPAFLGRLKVIPYYPISDEVLEQIIKLKLGRIANRIAENHKAEFSYDKALVEAVLARCT
EVDSGARNVDNILNGSLLPEIAESVLARMAEGQGISRIKVSAGKKGDFKYTIQ
 
Nucleotide Sequence: 2682 bp     [Download]
>gi|300309346|ref|NC_014323.1|:816027-818708 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGGGCATCAACCTCAAATCGCTGATCAGCAAGCTCAACGACAGCAGCCGCCTCGCCACCGAACGTGCTG
CCAGCCTGTGCATGGCGCGCGGCCAGTATGAAGTGGACCTGGAGCACCTGTTCCTGGCGCTGCTGGAAAA
CCCGCAGACCGACTTCAGCCTGATCGTGCGCCGCAGCGGCATCAGCCCCGACAGCCTGCAGGCCGATCTG
GAACACGAGATCAGCCAGTTCAAGAACGGCAACACCCGCACCCCGGTGCTCTCGTCCCATCTGCAGACGC
TGTTCGAACATGGCTGGCTGATCGCCTCGCTCGATGGCGAGCGCCCCAGCATCCGCAGCGGTCATCTGCT
GCTGGCGCTGCTGACCCAGACCGAGCTGGCGCAACTGGCCTATCGCGGCTCCAAACTGTTTGCCCGCTTC
AAGGTGGATGAACTCAAGCACGACCTGGCCAAGCTGACCGAAGGCTCGGTGGAAGCCCCCGCCTTGGCAT
CGGCATCGGCATCGGCAGCCGCAGATGGGCAGGCAGACGAGCAGCAGGGCGGCGACCCGGTCGGCGAAAT
GCGCGCTGGCGGCAGGACACCCGCGCTGGACCAGTACACCACCAACCTCACCCAACGCGCCCGCGAGGGC
AAGATCGACCCGGTCGTCGGCCGCGATGGCGAGATCCGCCAGGCCGTCGATATCCTGCTGCGGCGCCGCC
AGAACAACCCCATCCTCACCGGTGAAGCCGGCGTGGGCAAGACCGCCGTGGTCGAAGGGCTGGCGCTGCG
CATCGCCCAGGATGATGTGCCGCAGGCCCTGCAGGGCGTGGAGATCCACACGCTGGACATGGGCCTGCTG
CAGGCCGGCGCCAGCGTCAAGGGCGAGTTCGAGAACCGCCTCAAGGGCGTCATCGACGAGGTCAAGAAGA
GCCCGCATCCCATCATCCTCTTCATCGACGAAGCCCATACCATGATCGGCGCCGGCGGCCAGGCCGGCCA
GAACGACGCCGCCAACCTGCTCAAGCCAGCGCTGGCGCGGGGCGAGCTACGCACCATCGCCGCCACCACC
TGGAGCGAGTACAAGAAGTACTTCGAGAAGGACGCCGCCCTGGCCCGCCGCTTCCAGGTCATCAAGGTCG
AGGAACCGACCGAAGAAGTCGCCTGCGCCATGCTGCGCGCCATGGCCCCGCTGATGGAAAAGCACTTCGG
CGTGCGCGTCTACGACGAAGCCATCACCGAAGCCGTGCGCCTGTCGCATCGCTATATCAGCGGCCGCCAG
CTGCCCGACAAGGCCATCAGCGTGCTCGACACCGCCTGCGCCAAGGTGGCCCTGGGCCAGAACGCCACCC
CCGCGCGCCTGGAAGGCGTGACCCGTCGCCTGGAACGGCTCGCCGCCGAGATCGCCGCACTGGAGCGCGA
AACCCGCAGCGGCGCTTCCCACGCCACCCGTCTGGGCGAACTGCAGGCCCAGCACGCGCAGGCCATCGCC
GAGCAGACCGAGCTGCAGCAACGCTGGGAGCAGGAGCGCGAACTCAATGGCCGCATCCAGGCCGCCCGCG
CCGCGCTGGAAGAGGCCAACCAGGAAAGCGCCAGCAGTCAGGACAGCGCGGCCGCCCGCAGCGAGTTGCA
GCAGCTGCTGGCCCAGTTGAAGGAGCATCAGGGCGAAACGCCGATGGTGCCAGTGCAGGTCGATGGCCAT
GTGGTGGCCGAGATCGTGGCTGGCTGGACCGGCATCCCGCTGGGCAAGATGGTCAAGGACGAGATCAAGA
CCGTGCTGGGACTGGATGCGCTGCTCAAGGAGCGCGTGCTCGGCCAGCCGCAGGCCACCGCCGCCGTCGC
GCAGCGCGTGCGCACCTCGCGCGCCAACCTCGATGATCCCGGCAAGCCCAAGGGCGTGTTCCTGTTCGTC
GGCCCCTCCGGCGTGGGCAAGACCGAGACCGCCCTGGCCCTGGCCGACGTGCTCTACGGCGGCGAACGCA
AGCTCATCACCATCAACATGAGCGAGTACCAGGAAGCCCACACCGTCTCGGGCCTCAAAGGCTCGCCCCC
AGGCTACGTCGGCTACGGCGAAGGCGGCGTGCTCACCGAAGCGGTGCGACGCAATCCCTACAGCGTGGTG
CTGCTCGACGAAGTCGAGAAAGCCCACCCGGACGTGCTGGAGCTGTTCTTCCAGGTCTTCGACAAGGGCG
TGATGGACGATGGCGAAGGGCGCGAGATCGACTTCAAGAACACCATCATCATCCTCACCAGCAACGTCGC
TTCCTCGCAGCTGATGCAGGCCTGCCTGAACAAGAGCGCCGCCGAGCTGCCAACGCCGGACGAACTCGAC
GTGCTGATCCGCCCGCAACTGGTCAAGGCCTTCAAGCCGGCTTTCCTCGGTCGCCTGAAGGTCATTCCCT
ACTATCCGATCAGCGACGAGGTGCTCGAGCAGATCATCAAGCTCAAGCTCGGACGCATCGCCAATCGCAT
CGCCGAGAACCACAAGGCCGAGTTCAGCTATGACAAGGCGCTGGTCGAAGCCGTGCTGGCGCGCTGCACC
GAAGTGGATTCAGGCGCGCGCAATGTCGACAACATCCTCAACGGCAGCCTGCTGCCCGAGATTGCCGAGA
GCGTGCTGGCGCGCATGGCCGAAGGCCAGGGCATCAGCCGCATCAAGGTGTCGGCCGGCAAGAAGGGCGA
CTTCAAATACACCATCCAGTAA