SecReT6
Protein ID: 300310083
SecReT6 ID405
T6SS typei4b
Gene symbolvgr
Locus tagHsero_0748
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]818820..821654 [+]
ProductVGR-related type VI secretion system protein
NoteTssI
UniProt IDD8IZE7
KEGG IDhse:Hsero_0748
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-70, Aligned region: 62..372
Phage_GPD [PF05954], Evalue: 1.70E-70, Aligned region: 612..730
DUF2345 [PF10106], Evalue: 3.20E-37, Aligned region: 655..730
DUF2345 [PF10106], Evalue: 3.20E-37, Aligned region: 758..922
T6SS_Vgr [PF13296], Evalue: 3.10E-22, Aligned region: 607..712
T6SS_Vgr [PF13296], Evalue: 3.10E-22, Aligned region: 855..870
Phage_base_V [PF04717], Evalue: 8.70E-16, Aligned region: 352..371
Phage_base_V [PF04717], Evalue: 8.70E-16, Aligned region: 448..556
Protein Sequence: 944 a.a.     [Download]
>gi|300310083|ref|YP_003774175.1| VGR-related type VI secretion system protein [Herbaspirillum seropedicae SmR1]
MNLSDLPALFGAWSQSARVMRLHTPLDQDYGPHALMAERLQAVEQVGPGEDSSAIDQAIAGYRLQLSCLS
LNADISLRKLLGQPVLLELDTDGGARAFHGHVTACRMEGANGGMARYLLTIEPWLSFLRHRRDSAVFQDM
SAPAIIEAVFADYRGQGRLQPAWRLDLQDASAYAKRSLATQYQETDLAFVTRLMVEEGLFYYIEHQGDSN
SASLGSHTVVIADHNGSFKPNARSTVAFAQTNAVMAQDNIDRWRSVRRWQTNAVEILTWDYRQTAVRAAS
TASSGENAHDKLVLTSRDAPGQYINESPEQAQRQALNQMQAIEVRNKVFTGAGTVRSFLPGTTFTLTGHY
DHDGGDDDQFVLLRVVHQAHNNLSADLKAGVTALLGQAQLDDHDHKGSLLDTALRSADTQARPVYRNRFE
AIRNKIPYRPLLVDAQGERLYPKPQAHGQQSAVVVGAQGQAVHTDRDNRIRVQFHWQRGERSHSGLSSPT
PDDHVGAPANEQAGTWVRVLAGLAPTAGANWGGQAVPRVGQEVLIDFIEGDIDRPVVIGTLYNGRGVDNA
QGNQAGQGAGSATGNAPAWFPGSSGAHNHAAVLSGIKTQALSASQSGGGGYNQLVFDDSPGQARAALQQH
ADAHDGASELNLGLLRQQTDNQRLATTGQGFELKTLYSAALRAGQGLLVSTEKSISAQLDMTQGLSQLSE
SAQKQQQLAETAQKHNARLEGESDAAKLPAVEAMGESIEVLKATQSASTGSSGSDGQGSSATTATTAFSA
PQLQLSSPAGIAAVTPASAIIAAGVTSSVTAGKDINQIAQGNLHYLSKSGISLFTYGKASNGSKPNQETG
MALHAAAGKVSVQSQAGQTLLTSAKQLTVASVGKDVSVAGKQHVQLAAQGAWLRLEGGNIEVHGPGAMEF
RASAKELTGPASSGSSASVPAPGPLADCEYKSGA
 
Nucleotide Sequence: 2835 bp     [Download]
>gi|300309346|ref|NC_014323.1|:818820-821654 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGAACCTGTCGGACCTGCCCGCCCTGTTCGGCGCGTGGAGCCAGTCGGCCCGCGTGATGCGCCTGCATA
CCCCGCTGGACCAGGACTACGGCCCCCATGCCCTGATGGCCGAGCGCCTGCAGGCGGTGGAGCAGGTCGG
CCCGGGTGAGGACAGCAGCGCCATCGATCAAGCCATCGCCGGCTATCGTCTGCAGCTGTCGTGCCTGAGC
CTGAACGCCGACATCTCGCTGCGCAAGCTGCTGGGCCAGCCCGTGCTGCTGGAACTGGATACCGATGGCG
GCGCGCGCGCCTTCCACGGCCATGTGACCGCCTGCCGCATGGAAGGCGCCAATGGCGGCATGGCCCGCTA
CCTGTTGACCATCGAACCCTGGCTGTCCTTCCTGCGGCACCGCCGCGACAGCGCCGTGTTCCAGGACATG
AGCGCACCCGCCATCATCGAAGCCGTCTTCGCCGACTATCGCGGCCAGGGCCGTCTGCAACCCGCCTGGC
GACTGGATCTGCAGGATGCCTCGGCCTATGCCAAGCGCAGCCTGGCCACGCAGTACCAGGAAACCGACCT
GGCCTTCGTCACCCGCCTCATGGTCGAGGAAGGGCTGTTCTACTATATCGAGCACCAGGGCGACAGCAAC
AGCGCCAGCCTGGGCAGCCATACGGTGGTGATCGCCGACCATAACGGTAGCTTCAAGCCCAATGCGCGCT
CCACCGTCGCCTTTGCGCAAACCAACGCCGTGATGGCCCAGGACAACATCGACCGCTGGCGCAGCGTACG
CCGCTGGCAGACCAATGCGGTCGAGATCCTCACCTGGGATTACCGCCAGACCGCCGTGCGCGCGGCCAGC
ACCGCCAGCAGCGGCGAGAACGCCCATGACAAGCTGGTCCTCACCAGCCGCGACGCCCCCGGCCAATACA
TCAACGAGAGCCCCGAACAGGCGCAGCGCCAGGCGCTCAACCAGATGCAGGCCATCGAAGTGCGCAACAA
GGTCTTCACCGGCGCGGGCACCGTGCGCAGCTTCCTGCCCGGCACCACCTTCACGCTCACCGGCCACTAC
GACCACGACGGCGGCGACGACGACCAGTTCGTCCTGCTGCGCGTGGTCCACCAGGCGCACAACAACCTGA
GCGCCGACCTCAAGGCCGGCGTGACGGCGCTGCTGGGCCAAGCCCAGCTGGACGATCACGACCACAAAGG
CAGCCTGCTCGACACCGCCTTGCGCTCCGCCGATACGCAGGCGCGCCCGGTCTACCGCAACCGCTTCGAA
GCCATCCGCAACAAGATTCCCTATCGCCCCCTGCTGGTCGATGCCCAGGGCGAACGCCTTTATCCCAAGC
CCCAGGCCCATGGCCAGCAGAGCGCCGTGGTCGTAGGCGCGCAGGGCCAGGCCGTGCACACTGACCGCGA
CAACCGCATCCGCGTGCAATTCCACTGGCAGCGCGGCGAGCGCAGCCACAGCGGCCTGTCCTCACCGACG
CCTGACGATCATGTGGGCGCCCCCGCCAACGAACAGGCCGGCACCTGGGTGCGCGTGCTGGCGGGCCTCG
CGCCCACGGCCGGCGCCAACTGGGGCGGCCAGGCCGTGCCTCGCGTGGGCCAGGAAGTGCTGATCGATTT
CATCGAAGGTGATATCGACCGACCGGTGGTGATCGGCACCCTCTACAACGGCCGCGGCGTCGACAATGCC
CAGGGCAACCAGGCCGGGCAGGGCGCAGGCAGCGCCACCGGCAATGCCCCGGCCTGGTTCCCGGGCAGCA
GTGGCGCGCACAATCATGCCGCCGTGCTCTCCGGCATCAAGACCCAGGCCCTCTCCGCCAGCCAGAGCGG
CGGCGGAGGCTATAACCAACTGGTATTCGACGACAGCCCCGGACAGGCGCGCGCAGCGCTGCAACAGCAC
GCCGACGCCCACGACGGCGCCAGCGAGCTCAACCTCGGCCTGCTGCGCCAGCAGACCGACAACCAGCGCC
TGGCCACGACCGGCCAGGGCTTCGAACTGAAGACCCTGTACAGCGCCGCGCTGCGCGCGGGGCAAGGCCT
GCTGGTCTCGACCGAAAAGAGCATCAGCGCCCAGCTCGACATGACGCAGGGACTGTCGCAATTGAGCGAG
AGCGCACAAAAGCAGCAGCAGCTGGCCGAGACCGCGCAAAAGCACAACGCCCGCCTGGAAGGCGAGAGCG
ACGCCGCCAAACTACCCGCGGTCGAAGCCATGGGGGAGAGCATTGAGGTGCTCAAGGCCACCCAGAGCGC
CAGCACCGGCAGCAGTGGCAGTGATGGCCAGGGCAGCAGCGCCACCACCGCCACAACCGCCTTCAGCGCC
CCGCAGCTGCAGCTCTCCAGCCCGGCCGGCATCGCCGCCGTCACCCCGGCCAGCGCCATCATCGCCGCGG
GTGTGACCAGCAGCGTCACCGCGGGCAAGGATATCAACCAGATCGCCCAAGGCAATCTGCATTACCTGAG
CAAATCCGGCATCAGCCTCTTCACCTATGGCAAGGCCAGCAACGGCAGCAAGCCGAACCAGGAAACCGGC
ATGGCCCTGCATGCAGCGGCGGGCAAGGTCAGCGTGCAGAGCCAGGCCGGGCAGACCTTGCTGACCTCGG
CCAAGCAGTTGACGGTGGCCAGCGTGGGCAAGGATGTCAGCGTTGCGGGCAAACAGCATGTGCAACTGGC
GGCGCAAGGCGCGTGGCTGCGGCTGGAAGGCGGCAATATCGAGGTGCATGGGCCGGGGGCGATGGAGTTC
AGGGCGAGTGCCAAGGAATTGACTGGGCCGGCCAGTTCTGGCTCCAGTGCCAGCGTGCCGGCGCCTGGGC
CGTTGGCTGATTGTGAGTACAAGAGTGGCGCCTGA