SecReT6
Protein ID: 300310090
SecReT6 ID405
T6SS typei4b
Gene symbol-
Locus tagHsero_0755
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]830344..831471 [+]
Producthypothetical protein
NoteTssA
UniProt IDD8IZF4
KEGG IDhse:Hsero_0755
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-23, Aligned region: 69..129
ImpA-rel_N [PF06812], Evalue: 1.10E-23, Aligned region: 223..237
Protein Sequence: 375 a.a.     [Download]
>gi|300310090|ref|YP_003774182.1| hypothetical protein Hsero_0755 [Herbaspirillum seropedicae SmR1]
MKLPTLKSLLGGKPAMSAIEPLLNPINDNAPAGEDLSFTADLDAIAEARRFDDPTLDQGEWVIDIKEADW
PFVEQHCARLLEGRSKDLRLAVWYSEAACKTRGLRGLGDGFLLVAGLFDRFWDNMYPQSEEGDHDQRVGN
LTWLLARSVAMSREIALTEGRGSAYSLIDFEAARTRAANAERIANEGGQPEEGVKLAVMEAARKRSSHAF
YEAMLADSQYCVQALEQLEKSVDARLGVNGPGFSAAREALIAVRETVARFAADTGLRSPQLQDSAASGAA
ADASAPPTSVEETPPAGAMMQQGPIRTRAEAIAQLRAVAEFFRRTEPHSPVAHLADKAAQWGEMPLHAWL
KSVIKDDSTLSHVEELLGLLPPRRE
 
Nucleotide Sequence: 1128 bp     [Download]
>gi|300309346|ref|NC_014323.1|:830344-831471 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGAAGCTACCAACGCTCAAATCCCTCTTGGGGGGCAAACCAGCCATGTCCGCCATTGAACCTCTGCTCA
ATCCCATCAACGACAATGCGCCTGCCGGCGAGGACCTGTCCTTCACGGCCGACCTCGACGCCATCGCCGA
GGCGCGTCGCTTCGACGATCCCACCCTGGATCAGGGCGAGTGGGTGATCGACATCAAGGAGGCCGACTGG
CCCTTCGTCGAACAACACTGCGCGCGCCTGCTGGAGGGACGCAGCAAGGACCTGCGGCTGGCGGTGTGGT
ACTCCGAGGCGGCCTGCAAGACGCGTGGCCTGCGCGGACTGGGTGACGGCTTCCTGCTGGTGGCGGGGCT
GTTCGATCGCTTCTGGGACAACATGTACCCGCAGTCGGAAGAGGGCGACCACGACCAGCGGGTCGGTAAC
CTGACCTGGCTGCTGGCCCGCAGCGTGGCGATGTCGCGCGAGATTGCGCTCACCGAAGGGCGCGGCAGCG
CCTATTCGCTGATCGATTTCGAGGCCGCCCGCACCCGCGCTGCCAATGCCGAGCGGATCGCCAACGAGGG
CGGGCAGCCGGAAGAGGGTGTCAAGCTGGCGGTCATGGAGGCGGCGCGCAAGCGTAGCTCGCACGCCTTC
TACGAGGCCATGCTGGCCGATTCGCAATACTGCGTGCAAGCCCTGGAGCAGTTGGAAAAATCCGTCGATG
CGCGCCTGGGCGTGAATGGTCCGGGCTTCTCGGCCGCGCGCGAGGCGCTCATTGCGGTGCGTGAGACCGT
GGCGCGCTTTGCGGCCGATACCGGGCTGCGCAGTCCGCAACTGCAAGACAGCGCGGCCAGTGGTGCTGCG
GCTGATGCGTCGGCTCCGCCAACATCGGTGGAAGAAACGCCGCCAGCAGGCGCAATGATGCAGCAAGGTC
CGATCCGCACCCGTGCCGAAGCCATTGCGCAGTTGCGCGCGGTGGCGGAGTTCTTCCGTCGCACCGAGCC
CCATAGCCCGGTCGCGCACCTGGCCGACAAGGCGGCGCAGTGGGGCGAAATGCCGCTGCATGCCTGGCTC
AAGAGTGTCATCAAGGATGATTCCACGCTCTCGCATGTGGAAGAATTGCTGGGCTTGCTGCCGCCGCGCA
GGGAGTGA