SecReT6
Protein ID: 300310091
SecReT6 ID405
T6SS typei4b
Gene symbol-
Locus tagHsero_0756
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]831617..832432 [-]
Productouter membrane protein and related peptidoglycan-associated (lipo)proteins
NoteTagL
UniProt IDD8IZF5, D8IZF5
KEGG IDhse:Hsero_0756
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.20E-21, Aligned region: 107..133
OmpA [PF00691], Evalue: 4.20E-21, Aligned region: 168..263
BON [PF04972], Evalue: 1.90E-09, Aligned region: 43..80
BON [PF04972], Evalue: 1.90E-09, Aligned region: 111..150
BON [PF04972], Evalue: 1.90E-09, Aligned region: 223..235
Protein Sequence: 271 a.a.     [Download]
>gi|300310091|ref|YP_003774183.1| outer membrane protein and related peptidoglycan-associated (lipo)proteins [Herbaspirillum seropedicae SmR1]
MDTSFFPSLRRPACVFAAALLCNLANVALAQNAAPPVATPAPGQVLVTGTVPDEASKAAALARLREVYGA
DRVVDQIAVGQVVLPANWNNHVQSLISPNLKAVSRGQLKIDGTTVSITGEVANEAQRQQIASDMASSLNS
SYTVNNGLRVSTSEQGLLDNALANRVVSFESGQATLTPEGKRILDEIAATMLKLKGRHVEIIGNTDNEGL
RASNISLSLARADAVKAYLGAKGVDESLLSTSGQGPDRPVASNATAEGRAKNRRIEFRIAK
 
Nucleotide Sequence: 816 bp     [Download]
>gi|300309346|ref|NC_014323.1|:c832432-831617 Herbaspirillum seropedicae SmR1 chromosome, complete genome
TTGGATACGTCCTTCTTCCCTTCCCTGCGCCGGCCCGCCTGCGTATTCGCCGCGGCCCTGCTCTGCAACC
TCGCCAACGTCGCGCTGGCGCAGAACGCCGCGCCCCCCGTGGCCACGCCCGCCCCCGGCCAGGTACTGGT
CACCGGTACCGTCCCTGACGAAGCCAGCAAGGCCGCCGCCCTGGCCCGCCTGCGCGAAGTCTATGGCGCC
GACCGCGTGGTCGACCAGATCGCCGTGGGCCAGGTAGTGCTGCCGGCCAACTGGAACAACCATGTGCAGA
GCCTGATCTCGCCCAATCTGAAAGCGGTCAGCCGCGGCCAGCTAAAGATCGACGGCACCACCGTCTCCAT
CACCGGCGAGGTCGCCAACGAAGCCCAGCGCCAGCAGATCGCCAGCGACATGGCCAGCAGCCTCAACTCG
TCCTATACCGTCAACAACGGGCTGCGCGTGTCCACCTCCGAGCAGGGCCTGCTGGATAACGCCCTGGCCA
ATCGCGTCGTCTCCTTCGAAAGCGGACAGGCCACCCTCACCCCCGAGGGCAAGCGCATCCTCGACGAGAT
CGCCGCCACCATGCTCAAGCTCAAGGGCCGTCATGTGGAAATCATCGGCAACACCGACAACGAAGGCCTG
CGCGCCAGCAATATCTCGCTGTCGCTGGCCCGTGCCGATGCAGTCAAGGCCTACCTGGGCGCCAAGGGCG
TCGACGAGAGCCTGCTGAGCACCTCTGGCCAAGGCCCGGATCGCCCGGTGGCCTCGAACGCCACGGCAGA
GGGGCGCGCAAAGAACCGCCGCATTGAATTCCGTATCGCCAAGTAA