SecReT6
Protein ID: 300310098
SecReT6 ID405
T6SS typei4b
Gene symbol-
Locus tagHsero_0763
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]841882..844830 [+]
ProductVGR-related protein
NoteTssI
UniProt IDD8IZG2
KEGG IDhse:Hsero_0763
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.50E-62, Aligned region: 50..367
DUF2345 [PF10106], Evalue: 1.70E-35, Aligned region: 177..230
DUF2345 [PF10106], Evalue: 1.70E-35, Aligned region: 791..951
T6SS_Vgr [PF13296], Evalue: 8.40E-30, Aligned region: 297..329
T6SS_Vgr [PF13296], Evalue: 8.40E-30, Aligned region: 624..734
T6SS_Vgr [PF13296], Evalue: 8.40E-30, Aligned region: 858..873
Phage_base_V [PF04717], Evalue: 6.70E-22, Aligned region: 463..561
Protein Sequence: 982 a.a.     [Download]
>gi|300310098|ref|YP_003774190.1| VGR-related protein [Herbaspirillum seropedicae SmR1]
MSDLLTQLMQFTGASRLYSLSLGDAAPAGELLVEAFAASEGLHAVGLREVIVLSLDAGLRLKSLIGQRAT
LVTTLSDGSRTQFSGLVNEAAKLGSEGGLARYRLRIVPWVWLLSQSHNSRVWQDKTVIDIVEDVFADYAP
HAAWTWTDEVAPFMQQVQPRSYTIQYRESNLAFVSRLLAAEGLSWRVEESADAASGHRLVLFADSTSPRA
FPEDLTSTSPLGGSGIRFHAGTAREEQDSIQALAARRALQPASFTLLSYDYKSKQAVATSLPTRHEFGGK
DAPRLESYDSPGLYAYTDAAEADHYARLHLEASEARNKLWQARSTVRTLRPGTRFTLADGPLGLSAAQDG
APRQYAVLSVMSVGVNNLPKDAAEGLAELFGPIPPLLEDCVAACEEGQSLLHGQSGPDSLQLLGQTDIAG
VIAQARQLGYANAFEAIRADVIWRPVLADGTGLRLHARATARGSQSAIVVGPQGETSASSAGEIHCDRLG
RVRIRFHWQGRNNDAAATCWVRVAQRAASGGAGMQFLPRIGQEVLVQFIEDDIDRPVIVGALYNGRGEGA
AAPTPGGDTAQAGSDDPARAFTSATDLQASGQGNLAGGNAPTWHGGSQDSDGHGNTAAQWGIRSKEFGGS
GYNQIVFDDTDAQGRIQLKTTQSGSELNLGHLIHTADNYRGSFRGTGAELRTDAYGALRAGGGILFSSYK
IEQNAASRDPAGDNVGGMALLKQAALLGKTFNEATLTHKTVGLASHLGPTQASASTINDSAAPLEAIRVA
ASGMVDGSPENSGADVAAANTQTGESKLPHSTAALIGIAAKEGLGAVAGQHMQLANGETVNLLSGADSQQ
VAGNQYRLRSGQALGVLAGAMAAGEGGTGLQMIAAQKNIDVQAQADGLTVQARDQVRVISANAGVDWAAA
KKITLSTAGGANITIEGGNITVQCPGKLTIHAAQKLFAGPVSKTLPLPQMPNSVCKDCILNAMKQGAPGV
LV
 
Nucleotide Sequence: 2949 bp     [Download]
>gi|300309346|ref|NC_014323.1|:841882-844830 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGTCTGACCTGCTGACGCAACTGATGCAATTCACCGGTGCGAGTCGCCTTTACAGCCTCTCGCTGGGCG
ACGCCGCGCCCGCTGGCGAATTGCTGGTGGAGGCATTTGCCGCCTCGGAAGGGCTGCATGCGGTCGGGCT
GCGCGAAGTCATCGTCCTGAGCCTGGACGCCGGGCTGCGCCTGAAGTCCTTGATCGGGCAGCGCGCCACC
CTGGTGACGACCTTGTCCGATGGCAGCCGCACCCAGTTCTCGGGGCTGGTCAACGAGGCCGCCAAGCTCG
GCAGTGAGGGCGGCCTGGCCCGTTATCGCTTGCGCATCGTGCCCTGGGTCTGGCTGCTCTCGCAGTCGCA
TAACAGCCGGGTGTGGCAGGACAAGACCGTCATCGACATCGTCGAAGATGTCTTTGCCGACTATGCGCCC
CACGCCGCCTGGACCTGGACGGATGAGGTGGCGCCCTTCATGCAGCAGGTGCAGCCGCGCAGCTATACGA
TCCAGTACCGCGAAAGCAATCTGGCCTTCGTCAGCCGCCTGCTGGCCGCCGAGGGCCTGTCATGGCGCGT
GGAGGAATCTGCCGACGCAGCATCCGGCCATCGGCTGGTGCTGTTCGCCGATTCGACTTCGCCGCGCGCC
TTCCCCGAAGACCTCACCAGCACCAGTCCGCTCGGCGGCAGCGGCATCCGCTTCCACGCCGGTACCGCCC
GCGAGGAGCAGGACAGCATCCAGGCGCTGGCCGCGCGCCGGGCCTTGCAGCCGGCCTCGTTCACCTTGCT
GTCCTACGATTACAAGAGCAAGCAGGCGGTGGCCACCAGCCTGCCCACCCGTCACGAATTCGGCGGCAAG
GACGCCCCCCGCCTGGAAAGCTATGACAGTCCAGGCCTGTATGCCTATACCGATGCGGCCGAGGCCGATC
ACTATGCCCGCCTGCACCTGGAGGCCAGTGAAGCCCGCAACAAGCTCTGGCAGGCGCGCAGCACCGTGCG
CACCTTGCGTCCCGGCACGCGCTTTACGCTGGCCGACGGTCCGCTGGGCCTGTCCGCTGCGCAGGATGGC
GCGCCCCGGCAATACGCCGTGCTGTCGGTGATGAGCGTGGGTGTCAACAATCTGCCCAAGGATGCGGCCG
AAGGCCTGGCCGAACTGTTCGGCCCGATTCCACCCTTGCTGGAAGACTGCGTGGCCGCCTGCGAAGAAGG
CCAGTCGCTGCTGCACGGCCAGTCCGGCCCGGACTCTCTGCAACTGCTGGGGCAGACCGACATTGCCGGG
GTGATCGCGCAAGCCCGCCAGCTGGGGTATGCCAATGCCTTCGAGGCGATTCGCGCCGACGTGATCTGGC
GCCCGGTGCTGGCCGATGGCACCGGCTTGCGCCTGCACGCGCGTGCCACCGCGCGCGGCAGCCAGAGCGC
CATCGTGGTGGGGCCGCAGGGCGAGACCAGCGCCAGCAGCGCCGGCGAGATCCATTGCGACCGCCTGGGG
CGTGTGCGCATCCGCTTCCACTGGCAGGGCCGCAACAATGACGCCGCTGCCACCTGCTGGGTGCGCGTGG
CGCAACGCGCAGCCAGCGGTGGCGCGGGCATGCAGTTCCTTCCTCGCATCGGCCAGGAGGTGCTGGTGCA
ATTCATCGAGGACGATATCGATCGGCCCGTCATCGTCGGCGCGCTCTACAACGGCCGTGGCGAGGGCGCC
GCTGCGCCCACGCCCGGCGGCGATACTGCGCAGGCCGGCAGCGACGATCCTGCCCGCGCCTTCACCAGCG
CCACCGACCTGCAGGCCAGCGGCCAGGGCAACCTGGCCGGCGGCAATGCACCGACCTGGCACGGCGGCAG
CCAGGACAGCGATGGCCACGGCAACACTGCCGCGCAATGGGGTATCCGCTCCAAGGAATTCGGCGGTTCG
GGCTACAACCAGATCGTCTTCGACGATACCGATGCGCAAGGGCGCATCCAGCTCAAGACCACCCAGTCGG
GCAGCGAGCTCAACCTCGGTCACCTGATCCACACCGCAGACAACTATCGCGGGAGCTTCCGTGGCACCGG
CGCAGAGTTGCGTACCGATGCCTATGGCGCGCTGCGCGCTGGCGGCGGCATCCTGTTCTCCAGCTACAAG
ATCGAGCAGAACGCCGCCTCCCGTGACCCGGCCGGCGACAATGTCGGCGGCATGGCCTTGCTCAAGCAGG
CCGCCTTGCTGGGCAAGACCTTCAACGAGGCCACGCTCACCCACAAGACGGTCGGCCTGGCCAGCCATCT
GGGACCGACCCAGGCCAGCGCCAGCACCATCAACGACAGTGCCGCGCCGTTGGAAGCCATTCGCGTGGCG
GCCTCCGGGATGGTCGATGGTTCGCCCGAGAACAGTGGCGCAGACGTGGCAGCGGCCAATACGCAAACCG
GCGAGAGCAAGCTCCCGCACAGCACCGCGGCGCTGATCGGCATCGCGGCCAAGGAGGGATTGGGCGCCGT
GGCCGGGCAGCACATGCAGCTGGCCAATGGCGAGACGGTCAATCTCCTCTCCGGCGCCGACAGCCAGCAG
GTCGCCGGCAACCAGTATCGCTTGCGCAGCGGCCAGGCGCTGGGCGTGCTGGCCGGGGCGATGGCGGCAG
GCGAGGGCGGCACTGGCTTGCAGATGATCGCCGCGCAGAAGAACATCGACGTACAGGCCCAGGCGGACGG
ACTCACCGTCCAGGCACGCGACCAGGTCCGCGTGATCAGCGCCAATGCCGGCGTAGACTGGGCCGCCGCC
AAGAAGATCACGCTCTCCACCGCCGGCGGGGCCAACATCACCATCGAGGGTGGCAACATCACCGTGCAGT
GTCCGGGCAAGCTGACCATTCATGCCGCCCAGAAGCTGTTCGCCGGCCCCGTGTCCAAGACGCTGCCCTT
GCCCCAGATGCCCAATAGCGTCTGCAAGGACTGCATCCTCAATGCCATGAAGCAGGGTGCGCCGGGAGTG
CTGGTATGA