SecReT6
Protein ID: 300313316
SecReT6 ID406
T6SS typei4b
Gene symbol-
Locus tagHsero_4029
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]4624137..4624940 [+]
Productlipoprotein
NoteTagL
UniProt IDD8IST4, D8IST4
KEGG IDhse:Hsero_4029
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.70E-20, Aligned region: 98..144
OmpA [PF00691], Evalue: 2.70E-20, Aligned region: 164..259
BON [PF04972], Evalue: 3.20E-07, Aligned region: 39..76
BON [PF04972], Evalue: 3.20E-07, Aligned region: 108..127
BON [PF04972], Evalue: 3.20E-07, Aligned region: 192..205
Protein Sequence: 267 a.a.     [Download]
>gi|300313316|ref|YP_003777408.1| lipoprotein [Herbaspirillum seropedicae SmR1]
MKTNILSLFYRLALSAVCLSCTTSDAQNLAPPVATPAPGQVLVTGTVPDEASKAAALTRLRELYGHDRVV
DQISVGPVVLPANWNNHVQKLISPNLKAVRQGQLKIDGTNVSISGEVSHEAQRQQIASDMATSLNSSYII
NNGLRVSTSEQGVLDNTLANRVVSFESGRATLTPEGKRILDEIAATMLQLKGRRVEIIGNTDNEGLRASN
ISLSLARADAVKAYLSTKGVDDSLLTTSGQGPDRPVASNATSEGRARNRRIEFRIAK
 
Nucleotide Sequence: 804 bp     [Download]
>gi|300309346|ref|NC_014323.1|:4624137-4624940 Herbaspirillum seropedicae SmR1 chromosome, complete genome
TTGAAGACGAACATTCTCTCCCTTTTCTATCGGCTGGCGTTGAGCGCGGTCTGCTTGTCCTGCACCACAA
GCGACGCGCAAAACCTCGCCCCGCCCGTGGCCACCCCAGCACCGGGCCAGGTTCTGGTCACCGGAACTGT
CCCGGACGAAGCCAGCAAAGCAGCAGCGCTGACGCGCCTGCGCGAACTCTACGGTCACGACCGGGTGGTA
GACCAGATTTCGGTCGGCCCGGTGGTCTTGCCCGCCAACTGGAACAACCATGTGCAGAAACTGATCTCAC
CCAACCTCAAGGCGGTCAGACAGGGCCAATTGAAGATCGACGGCACCAACGTGAGCATCTCGGGTGAAGT
CTCCCATGAAGCGCAACGCCAGCAGATCGCCAGCGACATGGCCACCAGCCTCAATTCATCCTATATCATC
AACAATGGCTTGCGCGTCTCAACGTCTGAACAAGGAGTGCTGGACAACACCCTGGCCAATCGCGTTGTGT
CCTTCGAGAGCGGGCGCGCCACGCTCACCCCTGAAGGCAAGCGCATCCTCGATGAAATCGCTGCGACCAT
GTTGCAGCTCAAAGGTAGGCGCGTCGAGATCATCGGCAATACTGACAACGAAGGCCTGCGAGCAAGCAAC
ATCTCGCTTTCTCTGGCCCGCGCAGATGCGGTCAAGGCTTACCTGAGCACCAAGGGCGTCGATGACAGTC
TTCTGACCACGTCTGGCCAAGGTCCGGATCGCCCTGTGGCATCCAATGCCACATCCGAAGGACGCGCCAG
GAATCGCCGGATCGAGTTCCGGATCGCCAAGTAA