SecReT6
Protein ID: 300313317
SecReT6 ID406
T6SS typei4b
Gene symbol-
Locus tagHsero_4030
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]4625023..4626150 [-]
Producthypothetical protein
NoteTssA
UniProt IDD8IST5
KEGG IDhse:Hsero_4030
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.90E-24, Aligned region: 69..129
ImpA-rel_N [PF06812], Evalue: 8.90E-24, Aligned region: 242..261
Protein Sequence: 375 a.a.     [Download]
>gi|300313317|ref|YP_003777409.1| hypothetical protein Hsero_4030 [Herbaspirillum seropedicae SmR1]
MKLPTLKSALGTKLPTTVIDVLLKPISNEHPGGEDLSFTTDLDAIAQARRFDDPTLDQGEWVTDIKEADW
SFVEQRCAQLIETRSKDLRLAVWYGEAACKTRGLRGLGDGFLLMAGLFDQFWDHLYPLSEDGDHDRRVGN
LTWLLSRSVQMSHEIPLTEGRGSAFSLFDFNSARTRAANAERIVNEGGLPEEGVKLAVMESARKRSSHAF
YEAMLEDAQYCRHCLEQLENIVDHRLGVDGPGFSAAREATKLVHDTIVRFAAETGLRSAVSAESILIDGD
DAAVAAQLTGSGGSASAVLQHQGPIRTRAEAIGQLRAVAEFFRRSEPHSPVAHLADKAAQWGEMPLHAWL
RTVIKDGAALSHVEELLGLQAPQQD
 
Nucleotide Sequence: 1128 bp     [Download]
>gi|300309346|ref|NC_014323.1|:c4626150-4625023 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGAAACTACCGACCTTGAAATCCGCGCTGGGCACCAAGCTGCCCACTACCGTCATCGACGTGCTGCTCA
AGCCCATCAGCAATGAGCACCCCGGCGGCGAAGACCTGTCCTTCACAACCGACCTGGACGCTATTGCCCA
GGCGAGGCGTTTCGATGACCCGACCTTGGACCAAGGGGAATGGGTTACCGACATCAAGGAAGCCGACTGG
AGTTTCGTCGAGCAGCGTTGCGCCCAGCTCATCGAAACCCGTAGCAAAGACTTGCGTCTGGCCGTCTGGT
ACGGCGAAGCGGCTTGCAAGACCCGTGGCCTGCGCGGCTTGGGGGATGGATTTCTGTTGATGGCCGGTCT
GTTCGATCAGTTCTGGGATCATCTCTACCCGCTTTCGGAAGATGGCGACCACGACCGTCGCGTTGGCAAC
CTGACCTGGTTGTTGTCTCGATCGGTGCAAATGTCGCACGAGATCCCGCTGACCGAGGGACGCGGTAGCG
CCTTCTCCCTGTTCGATTTCAACAGCGCCCGCACCCGTGCCGCCAATGCCGAGCGCATCGTAAACGAAGG
CGGCCTGCCGGAAGAGGGCGTCAAGCTAGCCGTGATGGAATCGGCCCGCAAGCGCAGCTCGCACGCGTTC
TATGAAGCTATGCTGGAAGATGCCCAATACTGTCGCCATTGCCTTGAGCAACTCGAGAATATCGTGGACC
ACCGTCTTGGTGTCGATGGTCCCGGCTTCAGTGCCGCACGTGAAGCAACCAAGCTGGTACATGACACCAT
TGTCCGTTTCGCTGCTGAGACCGGGCTGCGTTCGGCGGTTTCAGCAGAGAGCATCTTGATTGACGGGGAC
GATGCCGCAGTGGCTGCACAGTTGACGGGATCCGGTGGCTCCGCCTCAGCCGTGCTTCAGCATCAAGGGC
CGATCCGTACCCGAGCTGAAGCCATCGGGCAACTGCGGGCCGTAGCTGAGTTTTTCCGCCGCAGCGAACC
GCATAGTCCGGTAGCGCATCTGGCTGACAAGGCCGCGCAGTGGGGGGAAATGCCCTTGCATGCCTGGCTC
AGGACCGTGATCAAGGACGGTGCCGCCTTGTCTCATGTCGAGGAATTACTGGGATTGCAGGCGCCACAGC
AGGATTGA