SecReT6
Protein ID: 300313318
SecReT6 ID406
T6SS typei4b
Gene symbolclpB
Locus tagHsero_4031
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]4626207..4628876 [-]
ProductClpA/B-type chaperone ATPase
NoteTssH
UniProt IDD8IST6
KEGG IDhse:Hsero_4031
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.60E-43, Aligned region: 234..274
AAA_2 [PF07724], Evalue: 2.60E-43, Aligned region: 618..787
AAA [PF00004], Evalue: 6.00E-19, Aligned region: 234..346
AAA [PF00004], Evalue: 6.00E-19, Aligned region: 624..742
AAA_5 [PF07728], Evalue: 6.60E-14, Aligned region: 234..257
AAA_5 [PF07728], Evalue: 6.60E-14, Aligned region: 623..744
ClpB_D2-small [PF10431], Evalue: 2.80E-11, Aligned region: 797..868
Clp_N [PF02861], Evalue: 2.30E-10, Aligned region: 23..74
Clp_N [PF02861], Evalue: 2.30E-10, Aligned region: 111..125
Clp_N [PF02861], Evalue: 2.30E-10, Aligned region: 521..536
AAA_16 [PF13191], Evalue: 1.30E-09, Aligned region: 211..256
AAA_16 [PF13191], Evalue: 1.30E-09, Aligned region: 278..317
AAA_16 [PF13191], Evalue: 1.30E-09, Aligned region: 420..501
AAA_16 [PF13191], Evalue: 1.30E-09, Aligned region: 618..664
AAA_16 [PF13191], Evalue: 1.30E-09, Aligned region: 689..712
AAA_22 [PF13401], Evalue: 5.10E-07, Aligned region: 233..320
AAA_22 [PF13401], Evalue: 5.10E-07, Aligned region: 425..480
AAA_22 [PF13401], Evalue: 5.10E-07, Aligned region: 620..644
AAA_22 [PF13401], Evalue: 5.10E-07, Aligned region: 685..717
Sigma54_activat [PF00158], Evalue: 3.90E-06, Aligned region: 228..314
Sigma54_activat [PF00158], Evalue: 3.90E-06, Aligned region: 623..748
AAA_29 [PF13555], Evalue: 3.30E-05, Aligned region: 225..250
AAA_29 [PF13555], Evalue: 3.30E-05, Aligned region: 619..648
AAA_17 [PF13207], Evalue: 3.40E-05, Aligned region: 234..281
AAA_17 [PF13207], Evalue: 3.40E-05, Aligned region: 623..659
AAA_25 [PF13481], Evalue: 3.80E-05, Aligned region: 234..258
AAA_25 [PF13481], Evalue: 3.80E-05, Aligned region: 496..512
AAA_25 [PF13481], Evalue: 3.80E-05, Aligned region: 619..645
IstB_IS21 [PF01695], Evalue: 0.00011, Aligned region: 228..255
IstB_IS21 [PF01695], Evalue: 0.00011, Aligned region: 623..641
AAA_19 [PF13245], Evalue: 0.00018, Aligned region: 232..256
AAA_19 [PF13245], Evalue: 0.00018, Aligned region: 621..645
NACHT [PF05729], Evalue: 0.00025, Aligned region: 234..261
NACHT [PF05729], Evalue: 0.00025, Aligned region: 624..643
AAA_23 [PF13476], Evalue: 0.00065, Aligned region: 234..251
AAA_23 [PF13476], Evalue: 0.00065, Aligned region: 480..512
AAA_23 [PF13476], Evalue: 0.00065, Aligned region: 620..731
Arch_ATPase [PF01637], Evalue: 0.0035, Aligned region: 285..316
Arch_ATPase [PF01637], Evalue: 0.0035, Aligned region: 622..664
Arch_ATPase [PF01637], Evalue: 0.0035, Aligned region: 694..718
RNA_helicase [PF00910], Evalue: 0.0037, Aligned region: 235..255
RNA_helicase [PF00910], Evalue: 0.0037, Aligned region: 624..645
RNA_helicase [PF00910], Evalue: 0.0037, Aligned region: 721..742
Zeta_toxin [PF06414], Evalue: 0.004, Aligned region: 234..256
Zeta_toxin [PF06414], Evalue: 0.004, Aligned region: 617..663
AAA_30 [PF13604], Evalue: 0.0044, Aligned region: 219..256
AAA_30 [PF13604], Evalue: 0.0044, Aligned region: 619..653
AAA_18 [PF13238], Evalue: 0.0066, Aligned region: 234..254
AAA_18 [PF13238], Evalue: 0.0066, Aligned region: 625..644
SRP54 [PF00448], Evalue: 0.0084, Aligned region: 234..255
SRP54 [PF00448], Evalue: 0.0084, Aligned region: 622..654
Protein Sequence: 889 a.a.     [Download]
>gi|300313318|ref|YP_003777410.1| ClpA/B-type chaperone ATPase [Herbaspirillum seropedicae SmR1]
MGINLRSLICKLNETARLATERAATLCVSCSHYEVDLEHLFLALLEQPQSDFSLIARRSGIDTDGLQADL
EHEISTFREGNARTPVLSPHLRTLFENGWLIASLEESNPSVRSAHLLLALLTQSDLSQLAYRGSKLFAKF
KIDEIKHNLHRLTEGSVESAAIGKTGQGGDRESGGDPMGELKQLRIGKMTALDQYTTQLTQRARDGKIDP
VIGRDAEIRQAVDILLRRRQNNPILTGEAGVGKTAVVEGLALRIAQGDVPKPLQGVEIHTLDMGLLQAGA
SVKGEFESRLKTVIDEVKKSAYPIILFIDEAHTMIGAAGQAGQSDAANLLKPALARGELRTIAATTWSEY
KKYFEKDAALARRFQVIKVEEPGEDVACAMLRAMVPLMEQHFGVRVYDEAVVEAVRLSHRYISGRQLPDK
AISVLDTACAKVALGRDATPALLEGVTRRLERLDTEISALRREAASGSQHEERLASLLDQHVCAVAERHD
LQLRWEQERELNERIQQARATLENPGTGDARGGNVDAARAELKQLLDELRQRQGDAPMVPIQVDGHVVAE
IVAAWTGIPLGKMVKDEIQTVLDLDALLQERVLGQPQATSAVAQRVRTSRANLDDPGKPKGVFLFVGPSG
VGKTETALALADVLYGGERKLITINMSEYQEAHTVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDE
VEKAHADVLELFFQVFDKGVMDDAEGREIDFKNTIIILTSNVASAQMMQACLNKSQEELPTPEELDTLIR
PQLIKTFKPAFLGRLKVVPYYPIADVVLVEIIKLKLARIAKRVAENHRVEFSYDKALVEAVLGRCTEVDS
GARNVDNILSGTLLPAVAESVLVRMAEGVEIRRIKVSASKKGDFKYTIQ
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|300309346|ref|NC_014323.1|:c4628876-4626207 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGGGAATCAATCTCAGATCATTAATTTGCAAACTCAATGAGACCGCACGCCTGGCTACCGAACGCGCCG
CCACGCTGTGCGTGTCATGTAGCCATTATGAAGTGGACCTGGAGCATCTCTTTCTGGCCTTGCTTGAGCA
ACCGCAGTCAGACTTCAGCCTGATCGCGCGCCGAAGCGGCATCGATACCGATGGCCTGCAAGCCGATCTG
GAGCACGAGATCTCGACCTTCAGAGAGGGCAATGCGCGTACTCCTGTCCTGTCTCCGCACCTGCGCACGT
TGTTCGAGAACGGATGGCTCATTGCCTCGCTGGAGGAAAGTAATCCTTCCGTTCGCAGTGCGCACTTGTT
GCTGGCGCTGCTGACTCAAAGCGATTTGTCGCAGCTTGCGTATCGTGGATCGAAGCTATTTGCCAAATTC
AAGATCGATGAAATCAAGCACAATTTGCACAGGCTTACCGAAGGATCCGTGGAGTCGGCTGCAATCGGCA
AGACAGGTCAGGGCGGCGACAGGGAGAGTGGTGGCGACCCGATGGGCGAACTCAAGCAGCTTCGCATCGG
CAAGATGACTGCGCTGGATCAGTACACTACGCAGCTAACGCAACGTGCCCGCGATGGCAAGATAGATCCG
GTCATTGGCCGCGATGCTGAGATCCGGCAGGCAGTCGATATTCTGCTCCGCCGTCGGCAAAACAATCCGA
TCCTGACCGGCGAGGCTGGCGTGGGAAAGACCGCCGTGGTGGAGGGGCTGGCCCTGCGTATCGCCCAGGG
CGATGTGCCGAAGCCCTTGCAGGGAGTTGAGATCCATACCCTGGACATGGGCCTGCTGCAGGCGGGGGCT
AGCGTCAAGGGTGAGTTTGAGAGTCGCCTCAAAACCGTGATCGATGAGGTCAAGAAGAGCGCATATCCCA
TCATTCTCTTCATCGATGAGGCGCACACCATGATTGGCGCCGCTGGCCAGGCCGGCCAGAGCGATGCAGC
CAACCTGCTCAAGCCGGCCCTGGCGCGGGGCGAGCTACGCACGATCGCGGCAACCACCTGGAGCGAATAC
AAGAAATATTTCGAAAAAGATGCCGCGCTGGCCCGACGGTTCCAGGTCATCAAGGTAGAAGAGCCGGGCG
AGGATGTGGCCTGCGCGATGCTACGTGCCATGGTGCCTCTCATGGAGCAGCATTTCGGAGTGCGCGTCTA
TGATGAAGCCGTCGTCGAAGCCGTCAGGCTTTCGCACCGCTATATCAGCGGACGTCAGCTGCCCGACAAG
GCCATTAGTGTGCTCGACACGGCCTGCGCCAAGGTGGCGCTCGGGCGGGATGCCACTCCCGCACTACTGG
AAGGTGTCACCCGACGCCTTGAGCGCCTGGATACGGAGATTTCGGCGCTCAGGCGTGAGGCTGCCAGCGG
TTCGCAGCATGAGGAGCGACTGGCGTCGCTGCTGGATCAGCATGTTTGTGCTGTAGCCGAACGGCATGAT
TTGCAGTTGCGCTGGGAGCAGGAGCGTGAACTCAACGAACGCATCCAGCAAGCTCGTGCCACTCTGGAAA
ATCCCGGTACGGGAGACGCCCGAGGCGGTAACGTGGACGCCGCTCGGGCGGAGCTGAAGCAGTTGTTGGA
TGAGCTCAGGCAACGCCAGGGTGACGCGCCGATGGTGCCGATCCAGGTGGATGGGCATGTGGTTGCCGAG
ATCGTGGCCGCGTGGACCGGAATCCCATTGGGTAAGATGGTCAAGGACGAAATCCAGACGGTGCTGGATC
TGGACGCATTGCTGCAAGAGCGTGTTCTAGGGCAGCCGCAGGCTACTTCAGCCGTGGCGCAGCGTGTACG
AACATCTCGGGCCAATCTGGATGATCCCGGCAAGCCCAAGGGCGTATTCCTGTTTGTGGGGCCGTCTGGG
GTAGGCAAGACCGAGACAGCGTTGGCGCTGGCTGATGTGCTCTACGGTGGCGAACGCAAGTTAATCACCA
TTAACATGAGCGAATACCAGGAAGCCCATACGGTCTCTGGCCTGAAGGGTTCGCCGCCCGGCTATGTCGG
CTATGGTGAAGGCGGTGTGCTGACCGAGGCCGTACGCCGCAATCCCTACAGTGTGGTGCTGCTCGACGAG
GTCGAGAAGGCCCACGCGGATGTCCTGGAGCTATTCTTCCAGGTCTTCGACAAGGGAGTGATGGATGATG
CCGAAGGACGCGAGATTGATTTCAAGAACACCATCATCATCCTCACCAGCAATGTGGCTTCCGCGCAGAT
GATGCAGGCTTGCTTGAACAAGAGCCAGGAAGAATTGCCTACCCCTGAAGAACTTGACACTCTGATTCGA
CCACAGCTGATCAAGACCTTCAAGCCGGCATTTCTCGGGCGCTTGAAGGTCGTTCCCTATTACCCGATTG
CCGACGTCGTGCTGGTCGAGATCATCAAGCTCAAGCTAGCGCGTATTGCCAAGCGTGTTGCCGAGAATCA
TAGGGTCGAGTTCAGCTACGACAAGGCGCTCGTCGAGGCTGTGCTGGGGCGTTGCACCGAGGTGGACTCG
GGCGCACGCAATGTTGACAACATCCTTAGCGGAACTCTTTTGCCTGCGGTTGCCGAAAGTGTGCTGGTGC
GCATGGCCGAAGGTGTGGAGATTCGCCGTATTAAGGTATCGGCCAGCAAGAAAGGTGATTTCAAGTACAC
CATCCAATAG