SecReT6
Protein ID: 300313319
SecReT6 ID406
T6SS typei4b
Gene symbol-
Locus tagHsero_4032
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]4628948..4630036 [-]
Producthypothetical protein
NoteTssG
UniProt IDD8IST7
KEGG IDhse:Hsero_4032
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.20E-81, Aligned region: 19..343
Protein Sequence: 362 a.a.     [Download]
>gi|300313319|ref|YP_003777411.1| hypothetical protein Hsero_4032 [Herbaspirillum seropedicae SmR1]
MQATQRRFEPSVIERLFAVPHRFQFFQAVRMIECWFRRNGVPHERAVSDFVRFANRTVLGFPASEIEAID
TYPSREGEAISVDNMEQALRCGQMKYVRITPTFMGFLGSSGSLPAHYTERVARHQIEHRDEGPRAFLDAF
STRSLALFYHAWNKYRLTFHYDVGRRDTFLPLLLSLSGLGFHSLRQRLQDGTGNGVRDESLGYFAGALRH
RPPSALYMQKVLGEYFSVPLQIEQFIGYWYKVPRQHQTVLGSTNSVLGKAMVGERVWQRDLRMRLRIGPV
AIRDFEKFLPGKEVSVALARMLGMFSGSTLEYEVEVALLAQDVRGMTLGSMREGGRLGWDSFVATAPETR
DRADLRYEISVQ
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|300309346|ref|NC_014323.1|:c4630036-4628948 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGCAGGCCACGCAGCGGAGATTTGAGCCTAGCGTGATCGAGCGGCTGTTCGCCGTTCCTCACCGCTTCC
AGTTTTTCCAAGCCGTGCGCATGATCGAATGCTGGTTCAGGCGCAATGGTGTGCCACACGAGCGTGCCGT
CAGCGACTTCGTGCGCTTTGCCAATCGTACAGTACTGGGATTTCCTGCCAGCGAGATCGAGGCCATCGAT
ACTTACCCGTCACGCGAGGGTGAGGCGATCTCGGTCGATAACATGGAGCAGGCGTTACGGTGTGGGCAGA
TGAAGTATGTCAGGATCACACCGACCTTCATGGGTTTTCTCGGAAGTAGTGGCTCCCTTCCCGCGCATTA
CACCGAACGTGTTGCGCGTCATCAGATTGAACACCGCGACGAAGGACCGCGTGCATTTCTGGACGCGTTT
TCCACTCGTTCACTAGCCTTGTTCTACCACGCATGGAACAAATATCGGCTGACGTTTCACTACGATGTAG
GTCGTCGCGACACATTTCTGCCTTTGCTGCTTTCGCTCTCCGGGCTCGGCTTCCATTCGCTGCGCCAGCG
TTTGCAGGATGGGACTGGCAACGGGGTGCGCGATGAATCCTTAGGGTATTTTGCAGGTGCCTTGCGCCAT
CGCCCACCCTCTGCACTGTACATGCAGAAGGTGCTGGGCGAGTATTTCTCGGTGCCGCTCCAGATCGAGC
AGTTCATCGGCTACTGGTACAAGGTTCCGCGCCAGCATCAGACTGTGCTTGGATCGACCAACTCCGTGCT
TGGGAAGGCGATGGTGGGCGAACGTGTCTGGCAGCGCGACCTGCGCATGCGGTTGCGCATCGGTCCCGTT
GCTATAAGAGATTTCGAGAAGTTCCTTCCAGGCAAGGAGGTTTCCGTGGCCTTAGCTCGCATGTTGGGCA
TGTTTAGCGGATCCACGCTTGAGTATGAAGTGGAGGTCGCACTACTTGCTCAGGACGTTCGCGGGATGAC
ACTGGGGAGCATGCGTGAAGGCGGGCGCCTGGGATGGGATAGTTTCGTCGCTACCGCTCCCGAAACTCGT
GATCGTGCTGATCTCCGCTACGAAATCTCTGTCCAGTGA