SecReT6
Protein ID: 300313320
SecReT6 ID406
T6SS typei4b
Gene symbol-
Locus tagHsero_4033
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]4630000..4631844 [-]
Producthypothetical protein
NoteTssF
UniProt IDD8IST8
KEGG IDhse:Hsero_4033
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.90E-194, Aligned region: 4..611
Protein Sequence: 614 a.a.     [Download]
>gi|300313320|ref|YP_003777412.1| hypothetical protein Hsero_4033 [Herbaspirillum seropedicae SmR1]
MQELLPYYERELSFLRRYSRDFSERYPKIAGSLLMAGEICEDPHIERMIQSYALLNARVSKRLDDDYPQF
TEALFEVLYPHYLRPFPSCSIARMDCAESAEQLTSATIIPRGTTLSTRPVKGVVCQFQTVYDVPVAPICL
THAVFSPIIDAPEAVVLPTSVTSSLSIGIATAGEQLALAKLDLVSLRVFIDGEASFCAALRDSLFMRSAA
AWIELPGSRRWVPLPAIPLAEVGFADEDALIDFPSQSHPAYRHLTEYFAFPEKFNFFDIDLSAILAVLPA
DSKSFILHLGLSGLRADSHIARQLGGVSAANLLLGCTPVINLFSQRGDPIRLTHAGAYYPVLPDGRRAFG
YEVYSIDSVQLVRETPQGESITSFRPFYSLRHGQSPESDGHYWAMRRDELIALKSPGYETEISIVDIDFD
PSKIETDTLSIELTCTNRDLPALLAYGLPGGDLSLEGGGVIRTAALLRKPTLPSRFERGRGAQWRLISQL
SLNHLSLMRVGLEAFQEMLTLYDQSNSPISQRQISAIAAIDHRPATAWLPGNPFASLVRGIEVKLTVDEE
GFVGSGLHAFAGVIDRFMGLYVHANSFSQLTVISKRTGEELLKCRPRSGDLSLA
 
Nucleotide Sequence: 1845 bp     [Download]
>gi|300309346|ref|NC_014323.1|:c4631844-4630000 Herbaspirillum seropedicae SmR1 chromosome, complete genome
GTGCAAGAGCTTCTGCCATATTACGAGCGCGAGCTGAGCTTTCTGCGCCGCTACTCCCGGGATTTCTCCG
AGCGTTACCCAAAGATTGCGGGCAGCTTGCTGATGGCTGGCGAGATCTGTGAGGATCCTCATATCGAGCG
CATGATCCAGTCCTATGCGTTGCTCAATGCACGTGTCTCCAAGCGTTTGGATGATGATTACCCGCAGTTC
ACCGAGGCCTTGTTCGAGGTCCTTTATCCGCATTATCTTCGTCCCTTCCCGTCCTGTTCGATCGCCCGCA
TGGATTGCGCGGAATCGGCGGAACAACTGACCAGTGCCACCATCATCCCTAGAGGTACGACGTTATCTAC
CCGACCGGTCAAGGGCGTGGTTTGCCAGTTTCAGACAGTTTATGATGTCCCGGTCGCTCCTATCTGTCTG
ACGCACGCGGTCTTCTCGCCGATCATTGACGCACCCGAAGCAGTGGTATTGCCGACTTCGGTGACGTCCT
CCCTCTCCATCGGCATCGCAACGGCGGGGGAGCAGCTGGCCTTGGCCAAGCTCGACCTGGTCTCGCTGCG
CGTTTTTATAGATGGCGAGGCATCTTTCTGCGCCGCCCTGCGAGACAGCTTATTTATGCGCAGCGCTGCC
GCCTGGATCGAGTTGCCGGGCAGTCGGCGTTGGGTTCCCTTGCCCGCGATCCCTTTGGCTGAGGTCGGAT
TCGCCGATGAGGATGCGTTGATCGATTTTCCTTCACAGTCTCATCCGGCATATCGCCATCTGACCGAGTA
TTTTGCCTTCCCCGAAAAATTCAATTTCTTTGATATTGACCTGTCGGCCATCCTTGCGGTCCTGCCTGCG
GACAGCAAAAGTTTCATCCTGCACCTGGGACTTTCCGGTCTGCGGGCCGATTCTCATATTGCCAGGCAGC
TTGGGGGAGTTAGTGCCGCCAATTTGCTGTTGGGTTGCACACCAGTGATCAATCTGTTCAGCCAACGCGG
CGATCCAATCCGGCTGACGCATGCTGGTGCTTACTATCCAGTATTACCCGATGGCCGGCGAGCCTTCGGT
TACGAGGTGTATTCGATTGATTCGGTGCAACTAGTACGGGAGACGCCGCAGGGCGAGTCCATCACAAGCT
TTCGCCCCTTCTACTCGCTGCGTCATGGCCAATCGCCCGAGAGTGATGGTCATTACTGGGCCATGCGCCG
TGACGAACTGATTGCATTGAAGAGTCCTGGCTATGAAACCGAGATATCCATCGTTGATATCGATTTCGAT
CCCTCCAAGATTGAGACCGATACTTTAAGCATCGAACTGACTTGCACCAACCGGGATCTTCCTGCCTTGC
TGGCCTATGGCCTGCCTGGCGGTGATCTGAGCCTGGAGGGCGGCGGCGTGATCCGTACCGCTGCCCTGCT
GCGCAAGCCGACATTGCCATCCCGCTTCGAGCGAGGGCGCGGGGCCCAATGGCGGTTGATTTCGCAACTG
TCGCTGAATCATCTTTCCCTCATGCGCGTCGGCCTCGAGGCCTTCCAGGAAATGCTGACGCTCTATGATC
AGTCCAATTCACCTATCTCACAACGGCAGATCAGTGCCATTGCTGCCATTGACCATCGACCTGCAACCGC
ATGGCTGCCTGGGAATCCGTTTGCCAGCCTTGTCCGCGGAATAGAGGTCAAGCTGACCGTTGATGAGGAA
GGTTTCGTGGGAAGTGGATTGCACGCCTTCGCGGGCGTGATCGATCGCTTCATGGGCTTGTACGTGCACG
CCAACAGCTTTTCGCAGCTGACCGTGATATCCAAAAGAACCGGAGAGGAATTGCTCAAATGCAGGCCACG
CAGCGGAGATTTGAGCCTAGCGTGA