SecReT6
Protein ID: 300313321
SecReT6 ID406
T6SS typei4b
Gene symbol-
Locus tagHsero_4034
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]4631845..4632333 [-]
Producthypothetical protein
NoteTssE
UniProt IDD8IST9
KEGG IDhse:Hsero_4034
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.10E-18, Aligned region: 31..135
Protein Sequence: 162 a.a.     [Download]
>gi|300313321|ref|YP_003777413.1| hypothetical protein Hsero_4034 [Herbaspirillum seropedicae SmR1]
MKGFAPSLFDKLMSEGPRASVGAVINRLSIEELKDVVARDLEAMLNTRSVIAEASLEQFPECSNSIITYG
LNDFAGMSLASLDDRSAICHSLEEAITRHEPRLRGVKATLEIQDGSINRLNFAISALLVVNAARETVNFD
AVLQPSTLQYSISKSRTTRIGV
 
Nucleotide Sequence: 489 bp     [Download]
>gi|300309346|ref|NC_014323.1|:c4632333-4631845 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGAAAGGCTTTGCGCCCAGCTTGTTTGACAAGCTGATGAGTGAGGGGCCACGTGCCTCTGTGGGTGCTG
TCATCAACCGTCTGTCAATAGAGGAACTCAAAGATGTCGTGGCACGTGACCTCGAGGCAATGCTCAATAC
GCGCTCTGTCATAGCTGAGGCGTCGTTGGAGCAATTCCCGGAATGCAGCAACTCCATCATCACCTATGGC
CTCAACGATTTCGCTGGAATGAGCCTGGCAAGCCTTGATGACCGCAGTGCTATATGTCATTCCCTGGAAG
AAGCCATCACGCGGCATGAGCCACGATTGCGCGGCGTGAAAGCAACGCTGGAAATTCAGGACGGTTCCAT
CAATCGACTCAACTTCGCCATCAGTGCCTTGCTGGTGGTTAACGCTGCGCGTGAGACTGTCAATTTTGAT
GCGGTGCTGCAGCCTTCGACATTGCAGTATTCCATCAGCAAGTCGCGAACGACACGCATAGGAGTGTAA