SecReT6
Protein ID: 300313322
SecReT6 ID406
T6SS typei4b
Gene symbol-
Locus tagHsero_4035
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]4632455..4632946 [-]
Producthypothetical protein
NoteTssD
UniProt IDD8ISU0
KEGG IDhse:Hsero_4035
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.80E-43, Aligned region: 6..139
Protein Sequence: 163 a.a.     [Download]
>gi|300313322|ref|YP_003777414.1| hypothetical protein Hsero_4035 [Herbaspirillum seropedicae SmR1]
MAIDVYIQIDGIKGESTDDLHKDWIECKTVDWEVLQPKSATASTGGGHTAERCEHKDIVFTKVADLASPL
LLQNSSSGKTIPKAKFEFMRADGKGERVRYFEIELTNVMISSVKPSIESGEILNETVGLKYSTVKWKYTQ
QKQGGGTAGNTSGGWDLSTNKVI
 
Nucleotide Sequence: 492 bp     [Download]
>gi|300309346|ref|NC_014323.1|:c4632946-4632455 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGGCAATTGACGTCTACATACAAATCGACGGAATCAAAGGTGAATCCACTGATGATCTGCACAAGGATT
GGATCGAATGCAAGACCGTTGATTGGGAAGTCCTTCAGCCGAAGTCGGCAACAGCATCGACTGGTGGTGG
TCACACCGCTGAACGGTGCGAACACAAGGACATCGTGTTCACCAAAGTGGCTGATCTGGCGTCGCCGCTG
CTGTTGCAAAACTCGTCCTCGGGCAAGACCATTCCCAAGGCAAAATTCGAGTTCATGCGGGCCGATGGTA
AGGGCGAGCGGGTTCGCTATTTCGAAATCGAACTGACCAACGTCATGATCAGCAGCGTGAAGCCGTCTAT
TGAGTCAGGTGAGATCCTGAACGAAACTGTCGGCCTGAAATACTCCACCGTGAAATGGAAGTATACCCAG
CAGAAGCAGGGTGGCGGTACTGCCGGCAACACTTCGGGTGGTTGGGACTTGTCAACCAATAAGGTCATTT
AA