SecReT6
Protein ID: 300313323
SecReT6 ID406
T6SS typei4b
Gene symbol-
Locus tagHsero_4036
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]4632981..4634474 [-]
Producthypothetical protein
NoteTssC
UniProt IDD8ISU1
KEGG IDhse:Hsero_4036
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.80E-190, Aligned region: 69..492
Protein Sequence: 497 a.a.     [Download]
>gi|300313323|ref|YP_003777415.1| hypothetical protein Hsero_4036 [Herbaspirillum seropedicae SmR1]
MSAQAHIEAAASAAPAAAGSTLLDDIVEQSKVAKSSSEHDRAKDLISELVSQVMEGTVVVSENLSATLDA
RIAELDRLISSQVSAIMHAPEFQKLEGSWTGLNYLVRNTTVGENQKIKILNATKKELVKDFNSALEFDQS
AMFKKVYEEEFGTFGGAPFGALLGDFEITRQPEDMYFIEQMSRIAAASHAPFITAASPELFGLESFSELG
KPRDLSKVFDTVEYAKWKSFRESEDSRYVGLTLPRFLGRLPFNPKDGTTVEGFNFVEDVDGTDHSKYLWC
NAAYAFGSKLTKAFEDFGWCAAIRGVEGGGLVEDLPTHTFKTDEGEVALKCPTEIAITDRREKELSDLGF
ISLVHCKNTDYAAFFGAQSAQKPKKYNSDAANANAVLSSQLQYIFAVSRIAHYMKSMMRDKIGSFAAASN
VEDFLNRWIAQYVLLDDNATQEAKAQFPLREASVQVSEVPGRPGVYRAVSFLRPHFQLDELSVSLRLVAE
LPQAGKS
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|300309346|ref|NC_014323.1|:c4634474-4632981 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGTCCGCTCAAGCCCATATCGAAGCCGCAGCAAGCGCTGCGCCTGCCGCTGCTGGCAGCACCCTTCTGG
ATGACATTGTTGAACAGAGCAAGGTCGCCAAGTCATCTTCCGAGCATGATCGCGCAAAGGACTTGATTTC
CGAGCTCGTCAGCCAGGTTATGGAAGGAACGGTGGTCGTATCGGAGAACCTGTCCGCTACCCTCGATGCG
CGTATTGCCGAACTGGATCGACTTATTTCCAGCCAGGTTAGCGCCATCATGCACGCACCGGAGTTCCAGA
AGCTTGAAGGTAGCTGGACCGGCCTGAATTATCTGGTACGCAATACCACTGTGGGCGAGAACCAGAAGAT
CAAGATCCTCAACGCAACCAAGAAGGAATTGGTCAAGGACTTCAACTCGGCGCTGGAATTTGACCAGAGC
GCCATGTTCAAGAAAGTCTACGAGGAGGAGTTTGGAACCTTTGGCGGCGCCCCCTTCGGGGCCTTGCTAG
GTGATTTCGAAATCACTCGGCAACCTGAGGACATGTACTTCATCGAGCAGATGTCGCGCATCGCCGCTGC
ATCTCATGCGCCTTTCATTACCGCAGCGTCACCGGAACTCTTCGGCCTGGAAAGCTTTTCCGAGCTTGGC
AAGCCACGTGATCTGTCGAAGGTCTTTGATACGGTCGAATATGCCAAATGGAAATCCTTCCGCGAATCCG
AAGATTCGCGCTATGTTGGCCTGACCTTGCCGCGCTTCCTCGGTCGCCTCCCCTTCAACCCAAAGGATGG
AACGACGGTGGAAGGATTTAATTTCGTCGAAGATGTAGATGGTACAGACCATTCAAAGTACCTGTGGTGC
AACGCAGCCTATGCCTTCGGTAGCAAGCTGACCAAGGCTTTCGAGGACTTTGGTTGGTGCGCCGCGATCC
GGGGCGTGGAGGGTGGTGGCTTGGTCGAGGATCTCCCTACCCACACGTTCAAGACCGACGAAGGAGAGGT
GGCGCTTAAATGTCCTACAGAAATCGCTATTACCGATCGTCGCGAAAAAGAGCTGTCGGACTTGGGGTTC
ATTTCGCTGGTTCATTGCAAGAATACAGACTACGCCGCCTTCTTTGGCGCGCAGTCGGCCCAGAAACCTA
AGAAGTACAACTCGGACGCCGCTAACGCCAACGCGGTTCTGTCGTCGCAGTTGCAGTACATATTTGCTGT
CTCGCGCATCGCTCATTATATGAAGTCGATGATGCGAGACAAGATTGGCAGCTTTGCTGCCGCTTCTAAC
GTCGAAGACTTCCTTAATCGCTGGATCGCGCAATACGTGCTGTTGGACGACAACGCCACGCAAGAGGCAA
AAGCGCAATTCCCGCTGCGCGAAGCTTCGGTACAGGTGTCGGAAGTGCCGGGACGACCAGGCGTTTATCG
CGCTGTGTCGTTCTTGCGTCCGCATTTTCAGTTGGATGAACTGTCCGTGTCGCTCAGGTTGGTTGCGGAG
TTGCCGCAGGCAGGTAAATCTTAA