SecReT6
Protein ID: 300313324
SecReT6 ID406
T6SS typei4b
Gene symbol-
Locus tagHsero_4037
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]4634485..4634985 [-]
Producthypothetical protein
NoteTssB
UniProt IDD8ISU2
KEGG IDhse:Hsero_4037
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.40E-57, Aligned region: 11..165
Protein Sequence: 166 a.a.     [Download]
>gi|300313324|ref|YP_003777416.1| hypothetical protein Hsero_4037 [Herbaspirillum seropedicae SmR1]
MAKKESIQKKLQKVRPPRVQMTYDVEIGDAIEKKELAFVTGVMGDFGGNSELPQPRLKDRKFINVDPDNF
DEVMKGIEPRAVYRVPNELSDKGGEFAVELKFRSMEDFRPESVVQQVEPLRKLLEARTRLADLRNKIAGN
EKLEDILNDVLNSTEKLAELSKQTNK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|300309346|ref|NC_014323.1|:c4634985-4634485 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGGCTAAGAAAGAAAGCATTCAGAAGAAACTGCAAAAGGTGCGTCCCCCGCGCGTGCAGATGACCTATG
ACGTCGAGATTGGCGACGCCATCGAAAAGAAGGAGCTGGCCTTCGTCACCGGCGTGATGGGCGATTTCGG
TGGAAACTCCGAGCTGCCCCAACCGCGTTTGAAGGATCGTAAATTCATCAACGTCGATCCAGACAATTTC
GACGAGGTGATGAAGGGAATAGAACCGCGCGCGGTCTACCGCGTACCCAACGAGCTTTCCGATAAAGGGG
GCGAGTTTGCAGTGGAATTGAAGTTTCGTTCAATGGAAGATTTTCGTCCCGAGTCCGTGGTACAGCAGGT
CGAGCCGCTGCGCAAGCTGCTGGAGGCGAGAACCAGGCTAGCCGATCTGCGCAATAAGATCGCCGGCAAC
GAAAAACTGGAAGACATCCTCAACGACGTTCTCAACAGTACCGAGAAGCTGGCCGAACTTAGCAAGCAAA
CCAACAAATAA