SecReT6
Protein ID: 300313326
SecReT6 ID406
T6SS typei4b
Gene symbol-
Locus tagHsero_4039
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]4636044..4636673 [+]
Producthypothetical protein
NoteTssJ
UniProt IDD8ISU4
KEGG IDhse:Hsero_4039
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.90E-33, Aligned region: 16..180
Protein Sequence: 209 a.a.     [Download]
>gi|300313326|ref|YP_003777418.1| hypothetical protein Hsero_4039 [Herbaspirillum seropedicae SmR1]
MKNQLTNHLATVIAIFSLSGCAAVGAASSVAQAARSTLEALGLKKAEPPEVPDAMKQPRSIPIKLHASRA
LNLDPQQRPLALVVKIYKLKQNISFQQASYDTFLSTQKEKEALGADLMEVKEITLVPDQRYEIIEKVSYE
AGYIGVVALFVNPAQQRWRIAFKADEAEKIGITVGVQSCSLTLGKGAAAVDTQGKPLEKDLTLAPVQCP
 
Nucleotide Sequence: 630 bp     [Download]
>gi|300309346|ref|NC_014323.1|:4636044-4636673 Herbaspirillum seropedicae SmR1 chromosome, complete genome
TTGAAAAACCAACTGACTAATCACTTGGCAACGGTAATCGCCATTTTTTCCCTATCCGGTTGTGCCGCCG
TCGGCGCTGCTTCCTCGGTCGCGCAAGCGGCAAGATCCACCCTCGAGGCACTTGGCCTGAAAAAAGCAGA
GCCACCGGAAGTCCCTGATGCGATGAAACAACCTCGAAGCATCCCTATCAAGCTGCATGCCTCCAGGGCG
CTCAATCTTGATCCGCAGCAGCGTCCGCTGGCCTTAGTCGTAAAAATCTACAAGCTGAAGCAGAACATAA
GTTTCCAACAGGCTTCATACGACACCTTTCTGAGTACGCAGAAAGAAAAGGAAGCCTTGGGAGCTGACCT
AATGGAGGTAAAGGAGATCACGCTGGTGCCAGATCAGCGCTATGAAATTATCGAGAAGGTAAGTTATGAA
GCGGGCTACATCGGCGTGGTCGCGCTTTTCGTCAATCCAGCCCAGCAGCGCTGGCGCATTGCCTTCAAGG
CTGATGAAGCGGAGAAAATCGGCATTACCGTCGGCGTGCAATCTTGCTCGCTGACCTTGGGTAAGGGTGC
GGCGGCTGTTGATACGCAAGGCAAGCCGTTAGAAAAAGATCTGACGCTGGCCCCAGTTCAGTGTCCTTGA