SecReT6
Protein ID: 300313327
SecReT6 ID406
T6SS typei4b
Gene symbol-
Locus tagHsero_4040
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]4636735..4638081 [+]
Producthypothetical protein
NoteTssK
UniProt IDD8ISU5
KEGG IDhse:Hsero_4040
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-129, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|300313327|ref|YP_003777419.1| hypothetical protein Hsero_4040 [Herbaspirillum seropedicae SmR1]
MNQSNKVLWGEGLFLRPQHFQRQDHYHEARLHQTALTLNPFCWGISSLKVDHDSLNNNTLRILELSAIFQ
DGEIYKAPDGDDLPDPIELTEIPLSQQSVTFYAALPVLKSFGSNFASGVANHQSSRYIQHNIETPDLFTD
AAKAELSYLKKAVRLASESEPRDSLVCIPIVRLRRSSSSGFELDPDFVAPSLSVHAAPLLFQRLRRLMDA
LQAKVSALYGHHREPSKNVVEFRSGDITSFWLLHTASTAYARLSHYLNNPLLHPERLYEQLLALAGSLMT
FSRSLMLADLPPYEHRDPGPPFARLDGIIRELLDTVISSRYFAIVLHESKPSYHMGMLDSGKINEKTNFY
LAVNADLPAIELVDVVPLRFKVGAPDDVEKFVLAALPGVKLVHSPQVPAALPVRPDTYYFTLESKGPMYE
RMLQAQSLCIYVPSGIRELKLELLAVTQ
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|300309346|ref|NC_014323.1|:4636735-4638081 Herbaspirillum seropedicae SmR1 chromosome, complete genome
GTGAACCAGTCCAACAAGGTCCTATGGGGCGAAGGTCTATTCCTGAGGCCACAACACTTCCAACGCCAGG
ACCACTACCACGAAGCGCGCCTGCACCAGACGGCGCTCACGCTCAATCCCTTTTGCTGGGGCATCTCTTC
TCTCAAGGTGGATCATGATTCCTTGAACAACAACACGCTACGCATCTTGGAACTGTCCGCGATCTTTCAG
GACGGAGAGATCTACAAGGCCCCGGATGGAGACGACCTGCCCGATCCTATCGAGCTGACCGAGATTCCGC
TATCGCAACAATCCGTCACCTTCTACGCTGCGCTTCCCGTGCTGAAAAGTTTCGGCAGCAATTTCGCCTC
AGGCGTGGCCAATCATCAGTCGAGCCGTTACATCCAGCACAATATCGAGACACCCGATCTGTTTACCGAC
GCCGCCAAGGCCGAATTGAGCTATCTGAAGAAAGCGGTCCGCCTCGCATCAGAGAGCGAACCGCGCGACT
CCCTGGTATGCATCCCCATCGTGAGGCTGCGCCGGTCTAGTTCATCAGGATTCGAACTAGACCCTGATTT
CGTCGCTCCCAGTTTGTCAGTCCACGCAGCGCCACTGTTATTCCAGCGCCTGCGCCGTCTTATGGATGCC
TTGCAGGCCAAGGTTAGCGCACTGTATGGCCATCATCGCGAGCCGAGCAAGAACGTAGTGGAATTCCGTT
CTGGCGACATCACCTCTTTCTGGTTGCTCCACACCGCCAGCACCGCTTATGCCCGGCTTTCACACTATCT
GAATAATCCCTTGCTGCATCCCGAGCGTCTGTATGAACAATTGCTAGCGTTGGCGGGCTCGCTGATGACG
TTCTCGCGCAGCCTGATGCTGGCGGACCTGCCTCCGTACGAACATCGCGATCCGGGCCCGCCGTTTGCTC
GGCTGGATGGCATCATTCGCGAACTTCTCGACACCGTTATCTCCTCGCGTTACTTCGCCATCGTGCTGCA
TGAGAGCAAGCCTTCTTACCACATGGGCATGCTGGACTCAGGCAAGATCAATGAGAAGACCAACTTCTAT
CTTGCAGTCAACGCCGACCTTCCCGCCATCGAACTGGTCGATGTTGTTCCATTGCGCTTCAAGGTCGGCG
CGCCCGACGATGTCGAAAAATTCGTACTCGCCGCGCTACCCGGAGTCAAGCTAGTGCATTCGCCGCAAGT
GCCGGCTGCTCTGCCGGTACGTCCTGATACGTATTACTTCACCCTCGAAAGCAAGGGCCCCATGTATGAA
CGGATGCTGCAAGCCCAATCACTATGCATCTATGTGCCTTCCGGCATCCGCGAACTTAAACTTGAACTGC
TGGCGGTAACACAATGA