SecReT6
Protein ID: 300313328
SecReT6 ID406
T6SS typei4b
Gene symbol-
Locus tagHsero_4041
StrainHerbaspirillum seropedicae SmR1
Repliconchromosome [GenBank: NC_014323] [Browse all T6SS(s) in this replicon]
Location [Strand]4638084..4638857 [+]
Producttype IV / VI secretion system transmembrane protein
NoteTssL
UniProt IDD8ISU6
KEGG IDhse:Hsero_4041
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-53, Aligned region: 27..228
Protein Sequence: 257 a.a.     [Download]
>gi|300313328|ref|YP_003777420.1| type IV / VI secretion system transmembrane protein [Herbaspirillum seropedicae SmR1]
MTSPPSLLDPTPLQMPVTTGAPINARSLLDLIYDGFYALFMLKNGGTPVDDVSFESKMQKFLGEVERNAK
KINASPDDIYAAKYAFCASVDEIILRSKFGIRPAWERRPLQLTMFGDQLAGENFFHKLEELRLHGNAHIQ
ALEVFHMCLLLGFQGKYALEGPEKLNYLTARLGDEIAHLKGKSAGFAPHWERPDAVINKLRNDVPLWVVI
SLFALITLFAYLGVRWMLISDTENGLAGYSDIVKLAPRTANLTITLP
 
Nucleotide Sequence: 774 bp     [Download]
>gi|300309346|ref|NC_014323.1|:4638084-4638857 Herbaspirillum seropedicae SmR1 chromosome, complete genome
ATGACTTCCCCCCCTTCTCTGCTTGATCCGACTCCTCTTCAGATGCCGGTGACGACAGGTGCTCCGATCA
ATGCGCGCTCACTACTGGATTTGATTTACGACGGTTTTTACGCACTCTTCATGCTCAAGAACGGCGGTAC
GCCCGTAGACGACGTTTCCTTCGAGAGCAAGATGCAGAAGTTTCTAGGCGAAGTCGAACGCAATGCCAAG
AAGATCAATGCCTCTCCAGATGATATCTATGCTGCGAAATATGCTTTTTGCGCTTCAGTCGATGAGATCA
TCCTGCGCTCCAAATTTGGAATCCGCCCTGCCTGGGAACGCCGCCCCTTGCAGTTGACCATGTTCGGCGA
CCAGTTGGCGGGTGAGAATTTCTTCCATAAATTGGAAGAGCTGCGGTTGCACGGGAATGCACACATCCAG
GCCCTAGAGGTTTTTCACATGTGCCTGCTGCTAGGATTTCAGGGAAAGTATGCGCTGGAAGGTCCTGAGA
AACTGAATTATCTGACAGCCCGACTGGGCGACGAAATCGCCCATCTCAAGGGCAAGAGCGCCGGCTTCGC
GCCTCACTGGGAGAGGCCCGACGCTGTCATCAACAAGCTGCGCAATGACGTTCCGCTTTGGGTGGTGATC
TCGCTGTTCGCACTGATCACCTTGTTCGCCTATCTGGGAGTGCGCTGGATGCTTATCAGCGACACCGAAA
ATGGGCTGGCCGGCTATTCAGATATCGTCAAATTGGCACCGCGCACTGCCAATCTGACCATTACTCTACC
CTGA