SecReT6
Protein ID: 30061768
SecReT6 ID46
T6SS typeN/A
Gene symbolsafA
Locus tagS0211
StrainShigella flexneri 2a str. 2457T
Repliconchromosome [GenBank: NC_004741] [Browse all T6SS(s) in this replicon]
Location [Strand]229169..230215 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ83SK5, E3Y9Z6
KEGG IDsfl:SF0202, sfx:S0211
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.00E-20, Aligned region: 51..110
ImpA-rel_N [PF06812], Evalue: 3.00E-20, Aligned region: 221..246
Protein Sequence: 348 a.a.     [Download]
>gi|30061768|ref|NP_835939.1| hypothetical protein S0211 [Shigella flexneri 2a str. 2457T]
MEIFLSDPISAECPCGPDLEYDPEYLLLFTRAAPREEAQYGDFVSTPENINWAELERDAHRLLMRSKDIR
ILVVLLRCRIQQAGARGLSEALTLLETLCSTYPDAIHPQLLATEDITAEDAAVARSNALAALLDHEGVMA
DIRGITLSNNAAMRLQVRDVERSLSALRPADALAPESVRQQLADLEARGTLPLDAFRQAAETTERLQRHA
RETLNDQAPDFSRLTQLLALLPGAVQSTTPEILPQPQAEQPENATIVHTEQMQAEQIALPVHIAEEISPM
TGAEPRQIRDRNDALERLRVIRRWFEHSEPSSPTIPLLRQAERLVGKRVSEVINEIPVELLEKWDALE
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|30061571|ref|NC_004741.1|:c230215-229169 Shigella flexneri 2a str. 2457T, complete genome
ATGGAAATATTCCTGTCTGACCCAATTTCGGCGGAATGCCCCTGCGGCCCGGATCTGGAGTACGATCCGG
AATACCTGCTGCTGTTCACCCGCGCCGCACCGCGTGAAGAAGCGCAATATGGCGATTTTGTCAGTACGCC
GGAAAACATTAACTGGGCGGAGCTTGAGCGGGACGCCCATCGTCTGCTGATGCGCAGCAAAGATATCCGC
ATTCTGGTTGTCCTGCTGCGCTGCCGTATCCAGCAGGCCGGTGCCAGGGGACTGTCGGAGGCGCTCACGC
TGCTGGAAACGTTGTGCTCCACGTACCCGGACGCCATCCATCCTCAACTGCTCGCGACTGAAGATATCAC
CGCCGAAGATGCTGCGGTGGCACGCAGTAACGCGCTGGCGGCGTTGCTGGACCACGAAGGTGTAATGGCG
GATATTCGTGGCATTACACTGTCAAATAATGCTGCCATGCGCCTTCAGGTGCGGGATGTGGAGCGTTCGC
TATCTGCATTACGCCCGGCGGATGCGCTGGCACCAGAATCGGTACGCCAGCAACTGGCAGACCTGGAAGC
GCGCGGCACACTGCCGCTGGATGCCTTTCGCCAGGCAGCAGAGACCACTGAGCGGCTGCAACGCCATGCG
CGTGAAACGCTGAATGACCAGGCACCGGACTTCTCCCGTCTGACGCAACTGCTGGCCCTGTTACCGGGAG
CAGTGCAGAGCACCACGCCGGAGATCCTGCCACAACCACAGGCTGAGCAGCCGGAAAACGCCACCATCGT
TCATACTGAACAGATGCAGGCAGAGCAGATTGCGCTACCGGTGCATATCGCGGAGGAAATATCACCGATG
ACCGGCGCAGAACCCCGGCAGATCCGCGACCGAAACGACGCGCTGGAACGCCTGCGTGTCATCCGTCGCT
GGTTTGAGCACAGCGAACCGAGCAGCCCGACCATTCCTTTGCTGCGCCAGGCAGAACGCCTGGTCGGAAA
ACGCGTCTCGGAGGTAATAAATGAAATTCCAGTAGAACTGCTGGAGAAATGGGATGCGCTGGAGTAA