SecReT6
Protein ID: 30061770
SecReT6 ID46
T6SS typeN/A
Gene symbolsafB
Locus tagS0213
StrainShigella flexneri 2a str. 2457T
Repliconchromosome [GenBank: NC_004741] [Browse all T6SS(s) in this replicon]
Location [Strand]230483..230788 [-]
Productperiplasmic chaperone of fimbral assembly machinery
NoteTssG
UniProt IDE3Y9Z3, Q83MB9
KEGG IDsfl:SF0203, sfx:S0213
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.50E-20, Aligned region: 10..99
Protein Sequence: 101 a.a.     [Download]
>gi|30061770|ref|NP_835941.1| periplasmic chaperone of fimbral assembly machinery [Shigella flexneri 2a str. 2457T]
MSNDFTQAQAPPWRYGFLNLMRRVDVQLCTVPAGNTWQPRMEKFRLGQTPALTFAPREIASVGWQEGRLH
ISLYSLVLWGPNGPLPLHYTELARNRTESRR
 
Nucleotide Sequence: 306 bp     [Download]
>gi|30061571|ref|NC_004741.1|:c230788-230483 Shigella flexneri 2a str. 2457T, complete genome
ATGAGCAACGATTTCACTCAGGCGCAGGCCCCCCCCTGGCGTTACGGTTTTCTGAACCTGATGCGCCGCG
TGGATGTGCAGTTGTGTACCGTTCCGGCGGGCAACACCTGGCAACCACGGATGGAAAAATTTCGCCTCGG
ACAAACGCCCGCGCTGACCTTTGCGCCACGAGAAATCGCCAGTGTGGGCTGGCAGGAAGGGCGCCTGCAC
ATCAGTCTGTACAGCCTCGTGCTGTGGGGGCCGAACGGTCCACTGCCGCTGCACTACACCGAACTGGCGC
GTAACCGGACTGAAAGCCGACGCTGA