SecReT6
Protein ID: 30061771
SecReT6 ID46
T6SS typeN/A
Gene symbolsafC
Locus tagS0214
StrainShigella flexneri 2a str. 2457T
Repliconchromosome [GenBank: NC_004741] [Browse all T6SS(s) in this replicon]
Location [Strand]230785..232668 [-]
Productouter membrane usher protein
NoteTssF
UniProt IDE3Y9Z2, Q83SK4
KEGG IDsfl:SF0204, sfx:S0214
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.50E-211, Aligned region: 5..625
Protein Sequence: 627 a.a.     [Download]
>gi|30061771|ref|NP_835942.1| outer membrane usher protein [Shigella flexneri 2a str. 2457T]
MDPRLLEYYNRELSYLRETGAEFAARHPKVAARLGMQGTDIADPYVERMVEAFSFLTARTQLKIDAEFPR
FTQRLLEVVSPNYVTPTPSMSVAQLHPDTEEGDLAKGFTVPRDTAFFSAIPEGESTACQFRSSQDVTLWP
LAIEEARLTAAPPDMPALHRYLPANIHVAGALRITLRTFGELTFSQLAGLDRLPFYLCGEERTASHLLEL
LHTSAIAPLAGIPGHFDGALDVNLQQPVMYEGLEPDQGLLPLAWNVFHGHNLLHEYFACPERFYFFTPTG
LSAGLQKIDGGVAEIVILLNRLPPDWLIHQTNAAQFSLFCTPVINLFPRVTARIDVTHSTTEQHLVVDRT
HPLDYEVFSVQEVEGLETDTTRKMAFRPLYHTRNNDEGNHGRYFSLRREPRRLSENARRYGTRTPYTGSE
VFLSLVDQYEAPYPENLRHITITAMVTNRDLPCLIARNGRDDLTVDAAIPVAGVGLIRPPRSPQPPMAER
EMAWRLIRQLSFNYLPLADLDHRTGGQALRDLLNLFIPAHDSPQSRQVRSLIGCKTTPVTRRLPGSGLLV
YGRGVSCELTVDEEGFSGISPYLFGLVLEHYIARHVSINTFSQMTLHSMQRGKIMTWPVRAGQRGSV
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|30061571|ref|NC_004741.1|:c232668-230785 Shigella flexneri 2a str. 2457T, complete genome
ATGGATCCACGGCTACTGGAATACTACAACCGCGAACTGAGCTATCTGCGGGAAACGGGAGCCGAATTTG
CCGCCCGTCATCCCAAAGTCGCCGCCCGGCTGGGCATGCAGGGAACGGATATTGCCGATCCGTATGTAGA
GCGAATGGTCGAGGCCTTCAGCTTCCTGACCGCCCGCACGCAGCTAAAAATTGACGCTGAATTCCCCCGT
TTCACCCAGCGCCTGCTGGAAGTGGTCAGCCCCAATTACGTCACACCCACGCCCTCAATGAGCGTGGCGC
AGTTGCATCCCGATACGGAAGAAGGCGATCTGGCGAAAGGATTTACCGTCCCGCGCGACACAGCCTTTTT
CTCCGCCATTCCGGAAGGCGAAAGCACTGCCTGCCAGTTTCGCAGCAGCCAGGATGTAACGCTGTGGCCG
CTCGCCATCGAAGAGGCGCGACTGACCGCCGCGCCACCGGATATGCCTGCCCTGCACCGCTACCTGCCGG
CCAACATTCACGTCGCCGGGGCGCTGCGTATTACCCTGCGCACCTTTGGTGAACTAACGTTCAGTCAGCT
TGCCGGACTGGACAGGCTGCCGTTTTATCTCTGCGGCGAGGAGCGTACGGCCTCACACCTGTTAGAACTT
CTACATACCAGCGCCATCGCGCCCCTGGCTGGCATTCCGGGGCATTTTGACGGCGCGCTGGATGTGAATC
TGCAACAGCCCGTTATGTACGAAGGCCTGGAGCCGGATCAGGGGCTGCTGCCGCTGGCGTGGAACGTGTT
TCACGGTCATAACCTGCTGCATGAATATTTTGCCTGTCCGGAACGCTTCTATTTTTTCACCCCGACAGGC
CTGTCTGCCGGATTACAGAAAATTGACGGTGGCGTGGCGGAGATTGTTATCCTGCTGAACCGCCTGCCGC
CGGACTGGCTGATCCACCAGACAAATGCGGCACAGTTCAGCCTGTTCTGTACCCCGGTTATCAACCTGTT
TCCCCGCGTCACCGCCCGGATCGATGTCACGCACAGCACGACGGAACAGCATCTGGTGGTGGACAGAACC
CATCCGCTGGATTATGAGGTGTTCTCGGTCCAGGAAGTGGAAGGGCTGGAAACCGACACCACACGGAAGA
TGGCCTTTCGCCCGCTCTACCACACCCGCAATAATGATGAAGGCAATCACGGACGTTATTTTTCCCTGCG
CCGGGAGCCCCGCCGCTTATCAGAAAACGCCCGCCGTTACGGCACCCGTACCCCCTATACGGGCTCGGAA
GTGTTCCTGTCGCTGGTTGACCAGTATGAAGCGCCGTACCCGGAAAATCTGCGCCACATCACCATCACGG
CCATGGTCACTAACCGCGATCTGCCCTGTCTTATTGCCCGCAATGGCCGGGACGATCTAACCGTGGATGC
AGCCATCCCGGTGGCGGGCGTAGGGCTTATCCGCCCGCCACGCTCGCCGCAGCCCCCGATGGCTGAACGT
GAGATGGCATGGCGGTTGATCCGCCAGTTATCTTTTAATTATCTGCCGCTGGCCGATCTGGATCACCGTA
CCGGCGGCCAGGCGTTGCGAGATCTGCTGAACCTGTTTATTCCTGCTCATGACAGTCCGCAATCGCGCCA
GGTGCGCAGCCTGATTGGTTGTAAAACGACCCCGGTCACCCGCCGTCTGCCCGGTTCCGGACTACTGGTC
TATGGGCGTGGCGTCAGTTGTGAACTGACGGTGGATGAAGAAGGTTTTTCCGGCATCAGTCCGTATCTGT
TCGGCCTGGTGCTGGAACACTATATCGCCCGCCATGTTTCCATTAATACCTTCTCGCAGATGACGCTGCA
CAGCATGCAGCGCGGCAAAATTATGACCTGGCCTGTCAGGGCGGGACAGCGGGGAAGCGTATGA