SecReT6
Protein ID: 30061773
SecReT6 ID46
T6SS typeN/A
Gene symbolsat1
Locus tagS0217
StrainShigella flexneri 2a str. 2457T
Repliconchromosome [GenBank: NC_004741] [Browse all T6SS(s) in this replicon]
Location [Strand]233373..234005 [-]
Producthypothetical protein
NoteTagJ
UniProt IDE3Y9Z0, Q83SK3
KEGG IDsfx:S0217
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.40E-22, Aligned region: 145..208
Protein Sequence: 210 a.a.     [Download]
>gi|30061773|ref|NP_835944.1| hypothetical protein S0217 [Shigella flexneri 2a str. 2457T]
MTNNNELPITLSALLRDYSVVEGIQMAEQQVRMHPAQASRRHSLFQLLCVAGDWSRALQQIQLCARMDAN
YTREAQVFGELIRCEIYRHACFQGEQRPGVILPPPAWMEDLLTALACNARGEAQEADAHRSRALEAITDT
SGQWNGGAFDWISDSDSRTGPVLELIAGGAYIWLPFSQICSLKSPRPAHLIDLIWKPVNVTLNNGDTHSA
 
Nucleotide Sequence: 633 bp     [Download]
>gi|30061571|ref|NC_004741.1|:c234005-233373 Shigella flexneri 2a str. 2457T, complete genome
ATGACAAACAATAACGAGCTACCGATTACCTTGTCGGCGCTGCTGCGGGATTATTCCGTGGTGGAGGGCA
TTCAGATGGCAGAGCAACAGGTCAGGATGCACCCAGCGCAGGCCTCCCGCCGCCACAGCCTGTTTCAGTT
ATTGTGCGTGGCAGGCGACTGGTCGCGGGCACTGCAACAGATCCAGCTATGCGCCCGGATGGACGCAAAT
TATACTCGCGAAGCGCAGGTATTTGGCGAGCTGATCCGCTGTGAGATATACCGCCACGCCTGCTTTCAGG
GCGAACAGCGGCCCGGTGTTATTCTCCCGCCGCCCGCCTGGATGGAGGATCTGCTGACCGCCCTCGCCTG
TAACGCCCGTGGTGAAGCGCAGGAAGCTGATGCTCACCGCAGCCGCGCGCTTGAGGCCATAACAGACACT
TCCGGGCAGTGGAATGGCGGCGCATTTGACTGGATTAGCGACAGCGACTCCCGTACCGGTCCGGTACTCG
AACTGATCGCGGGCGGAGCATATATCTGGCTGCCGTTTTCACAAATCTGTTCGCTGAAATCGCCGCGGCC
TGCGCATCTGATCGATTTGATCTGGAAACCCGTCAACGTCACCCTGAACAATGGCGATACACACAGTGCC
TAG