SecReT6
Protein ID: 300693661
SecReT6 ID404
T6SS typei4b
Gene symbol-
Locus tagRPSI07_mp0651
StrainRalstonia solanacearum PSI07
Repliconmegaplasmid [GenBank: NC_014310] [Browse all T6SS(s) in this replicon]
Location [Strand]798603..801947 [-]
Productrhs element vgr-like protein
NoteTssI
UniProt IDD8N3A4
KEGG IDrsl:RPSI07_mp0651
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.60E-62, Aligned region: 46..356
DUF2345 [PF10106], Evalue: 8.20E-44, Aligned region: 667..819
T6SS_Vgr [PF13296], Evalue: 1.60E-34, Aligned region: 518..628
Phage_base_V [PF04717], Evalue: 4.20E-17, Aligned region: 412..502
Protein Sequence: 1114 a.a.     [Download]
>gi|300693661|ref|YP_003749634.1| rhs element vgr-like protein [Ralstonia solanacearum PSI07]
MKSLFPVPAAVPQAVLGALLGQQTRQITLETALASDNLVVERFTAREAVSASFVLQVDCLSPSAHLDTVR
LASQEATLRLMLADGRRRAWHGYVVDCATLGGDGGLARYRLRIVPWLDRLHTRGDCFVYQDKTALEIIED
LFADYPVAHYKLAVSQPCAKRSICCQYRETDYAFVMRLLAEEGLSLRIEHEQRDERHDSSAQSRHCVVIF
DNDAERPACAQPEIRFHRVDATERDDAIERLSLTRTVGTNAVTVASWDYKALAATAAQATASDPGGELPT
LEAFEASGPYCFANTEGASRAARLRMQAHEGAYLRYAGIGSVRQLGAGQRFTLTQHFDTRHSAFVTLSVE
HEAANNLGADLARLLGTTAIESGSYRNRFVAVPAEAPIVPPYQRRPTAPEGQAAVVIADDGAPLTTDRDH
RVRIRFPWLRAPSVNAFSDPAGSARSQVTAWVRVATASAGPNWGAHHLPRAGTQVLLTFVDGDIDRPLAT
QQLHNAQDALPWPAADAPLGQALSGWHSQNLGGDGYNQWVVDDHPAQLRMRLASSAASSQLNLGYVVSHG
PTGGERGDWRGTGAELRTDAWAVVRAGGGLLLSTTARAQAGGTLLDAKEARGQFIAAQRTAQRLSDAAAS
QQALPLAANEAFDPLTQALDPAQDGHYPSRVNGQDATQPGSQSPVDKFAQPLLVAESPTSLALASQATTT
VYAGRHLHGTAQGDWHLAAGNVVAAAAAKGVSLFAQRNGIRVIAEGGSVSIQAHTDALAVMADQAVTVTS
STESVEILAQQNVVLRGGDSVIRMEGRAITFETQKLSVKGAGHPLIGPGGQAAELPGLPFGLLGATAAYD
EQIQFVNQHGEALPNVAYKILLADGTTVPGTTDKDGKTQRISTDKPTAIQTATLAPTEVIDCCGRTNTGS
IDPVKVPIADVTTNAVNVGGSVKTISVKGHDRPLTPGEIEMAKAIFKNSIDYNKVRVHKGSYFWFNLQSK
NTAVTPNGEMYFLAEDFEEDFSSPDGQAIYKRSWFMHEMTHVWQYQKGYSVRWHGLTVTIHGESAYKYDI
KPSNVFRDYNMEQQGNLVADYFALCILNNRRAVLHDGYVGSPHELQQVLLPLLQDPENENNLPK
 
Nucleotide Sequence: 3345 bp     [Download]
>gi|300693042|ref|NC_014310.1|:c801947-798603 Ralstonia solanacearum PSI07 megaplasmid, complete sequence
ATGAAGTCCTTGTTCCCCGTGCCGGCCGCCGTGCCGCAAGCCGTCCTGGGCGCGCTGCTCGGACAGCAGA
CCCGCCAGATCACGCTGGAGACAGCGCTGGCCTCCGACAACCTGGTGGTGGAGCGCTTCACGGCGCGCGA
GGCGGTCTCGGCGTCGTTCGTGCTGCAGGTCGATTGCCTGAGCCCCTCGGCCCACCTGGACACGGTCCGG
CTGGCCTCGCAGGAAGCCACGCTGCGCCTGATGCTCGCCGATGGCCGCCGCCGCGCCTGGCACGGCTACG
TGGTCGACTGCGCGACCCTGGGCGGCGACGGTGGACTGGCGCGCTACCGGCTGCGCATCGTGCCCTGGCT
CGACCGCCTGCACACCCGCGGCGACTGCTTCGTCTACCAGGACAAGACGGCGCTGGAGATCATCGAAGAC
CTCTTCGCCGATTACCCCGTCGCGCATTACAAGCTCGCGGTAAGCCAGCCGTGCGCCAAGCGCTCGATCT
GCTGCCAGTACCGCGAGACCGACTACGCCTTCGTGATGCGCCTGCTGGCCGAGGAAGGGCTGTCGTTGCG
CATCGAGCATGAGCAGCGCGACGAGCGGCACGACAGCAGCGCGCAATCGCGCCACTGCGTCGTCATCTTC
GACAACGACGCCGAGCGCCCCGCGTGCGCGCAGCCCGAGATCCGCTTCCACCGCGTCGATGCCACCGAAC
GCGACGACGCCATCGAGCGCCTCTCGCTGACCCGCACGGTCGGCACCAACGCCGTGACCGTGGCTTCGTG
GGACTACAAGGCCCTGGCCGCCACCGCCGCCCAGGCCACCGCCAGCGACCCCGGTGGCGAGCTGCCGACG
CTGGAAGCGTTCGAGGCATCCGGCCCCTACTGCTTCGCCAATACCGAGGGCGCCAGCCGCGCCGCTCGGC
TGCGCATGCAAGCCCACGAGGGCGCCTACCTGCGCTATGCGGGCATCGGCAGCGTGCGCCAGTTGGGCGC
CGGCCAGCGCTTCACGCTCACCCAGCACTTCGATACCCGCCACAGCGCCTTCGTCACCCTGTCGGTCGAG
CACGAGGCCGCCAACAACCTCGGCGCCGACCTCGCCCGCCTGCTGGGCACCACCGCCATCGAATCGGGCA
GCTACCGCAACCGCTTCGTCGCCGTGCCAGCCGAGGCGCCCATCGTGCCGCCCTACCAACGCCGCCCCAC
CGCCCCCGAAGGCCAGGCCGCCGTGGTGATCGCCGATGACGGCGCGCCGCTCACCACCGACCGCGACCAC
CGCGTGCGCATCCGCTTCCCGTGGCTGCGCGCGCCGTCGGTCAACGCCTTCTCCGATCCGGCCGGCAGCG
CCCGCTCGCAGGTCACCGCCTGGGTGCGTGTGGCGACCGCATCCGCCGGTCCGAACTGGGGCGCCCATCA
CCTGCCGCGCGCCGGCACCCAGGTGCTGCTGACCTTCGTCGACGGCGACATCGACCGGCCGCTGGCCACC
CAGCAGCTGCACAACGCGCAGGACGCGCTGCCCTGGCCCGCCGCCGATGCGCCGCTCGGGCAGGCGCTGT
CCGGCTGGCATTCGCAGAACCTGGGCGGCGACGGCTACAACCAGTGGGTGGTCGACGATCACCCCGCCCA
GCTGCGCATGCGGCTGGCCAGCTCGGCCGCCAGCAGCCAGCTCAACCTCGGCTACGTGGTCTCGCACGGC
CCGACCGGCGGCGAGCGCGGCGACTGGCGCGGCACCGGCGCGGAGCTGCGCACCGACGCGTGGGCCGTGG
TGCGGGCCGGTGGCGGCCTGCTGCTGTCCACCACGGCACGGGCACAGGCGGGCGGCACGCTGCTCGATGC
GAAGGAAGCACGCGGCCAGTTCATCGCCGCCCAGCGCACCGCGCAGCGCCTGTCCGACGCGGCGGCCAGC
CAGCAAGCGCTGCCGCTGGCGGCCAACGAGGCGTTCGACCCGCTCACGCAGGCGCTCGATCCGGCCCAGG
ACGGCCACTACCCGAGCCGCGTCAACGGCCAGGACGCCACCCAGCCCGGCAGCCAATCACCGGTCGACAA
GTTCGCCCAGCCGCTGCTGGTAGCGGAATCGCCCACCAGCCTCGCCCTGGCCTCGCAGGCCACGACCACG
GTCTATGCGGGGCGACACCTGCACGGCACGGCCCAGGGCGATTGGCACCTGGCCGCCGGCAACGTAGTGG
CGGCCGCCGCGGCCAAGGGGGTGAGCCTGTTTGCGCAGCGCAACGGCATCCGCGTCATCGCCGAGGGCGG
GTCGGTATCGATCCAGGCGCATACCGATGCGCTGGCCGTGATGGCGGATCAGGCGGTGACGGTGACCTCG
TCCACGGAATCGGTGGAGATCCTGGCGCAGCAGAACGTCGTGCTGCGGGGTGGGGATTCGGTGATCCGGA
TGGAGGGGCGTGCCATCACCTTCGAGACGCAGAAGCTGTCGGTGAAGGGGGCGGGGCATCCGTTGATTGG
ACCGGGGGGGCAGGCGGCGGAGTTGCCAGGGTTGCCGTTCGGCCTACTTGGAGCAACAGCTGCATATGAT
GAACAGATTCAGTTCGTCAATCAGCACGGCGAAGCGCTGCCGAATGTCGCGTACAAGATTCTATTGGCTG
ATGGAACCACTGTCCCTGGCACCACGGATAAAGACGGAAAAACTCAGCGCATCTCGACTGATAAACCCAC
CGCCATACAAACTGCAACTCTGGCACCAACAGAAGTAATCGATTGCTGCGGCCGTACCAACACGGGCTCA
ATCGATCCGGTAAAAGTACCCATCGCTGACGTCACCACCAACGCTGTCAATGTTGGGGGGTCTGTCAAAA
CCATTTCGGTGAAAGGTCACGACCGGCCACTAACTCCTGGTGAGATTGAAATGGCGAAGGCAATCTTTAA
GAACTCCATCGATTACAACAAAGTAAGAGTGCACAAGGGGAGCTACTTCTGGTTCAATCTACAAAGCAAG
AATACCGCTGTCACGCCCAATGGGGAAATGTATTTCCTTGCAGAAGATTTTGAGGAAGATTTTTCGTCGC
CCGACGGCCAAGCCATATATAAGCGATCGTGGTTCATGCACGAGATGACGCACGTATGGCAATACCAGAA
AGGGTACTCCGTCAGATGGCATGGCCTTACGGTAACGATTCACGGAGAAAGCGCATATAAATATGACATC
AAGCCCAGTAACGTATTTCGCGATTACAACATGGAACAACAAGGAAATCTTGTTGCTGACTATTTTGCAC
TATGCATACTAAATAACAGGCGCGCCGTTTTACACGACGGATATGTCGGCAGCCCGCACGAACTACAGCA
GGTGCTGTTGCCGCTACTTCAAGACCCAGAAAATGAAAACAATCTTCCGAAATAG